UniGene Name: sp_v3.0_unigene60196
Length: 159 nt
UniGene Fasta |
---|
>sp_v3.0_unigene60196
C |
Ace file of the UniGene sp_v3.0_unigene60196 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cellulose synthase-like D2-1, glycosyltransferase family 2 protein n=2 Tax=Selaginella moellendorffii RepID=D8R322_SELML | - | - | 5.0e-17 | 84% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
Sma3 | Cellulose synthase-like protein D4 | - | - | 7.576e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.945e-26 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 4.59e-12 | % |
Source | Gene names |
---|---|
Sma3 | At1g02730; At1g32180; At2g33100; At3g03050; At4g38190; At5g16910; CSLD1; CSLD2; CSLD3; CSLD4; CSLD5; CSLD6; CSLF6; CslD1; CslF10; CslF6; CslF7; CslF8; F20D10.310; F22D16.26; F25I18.16; F2K13.60; F3C3.4; GSVIVT00014029001; GSVIVT00015671001; GSVIVT00017182 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
Sma3 | 1,4-beta-D-xylan synthase activity | GO:0047517 | Molecular Function | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Sma3 | cell wall biogenesis | GO:0042546 | Biological Process | 0.0 | - |
Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G32180.1 | ATCSLD6, CSLD6 cellulose synthase-like D6 chr1:11586516-11589651 REVERSE LENGTH=979 | 5.0e-22 | 76% |
RefSeq | Arabidopsis thaliana | NP_174497.1 | putative cellulose synthase-like protein D6 [Arabidopsis thaliana] | 7.0e-22 | 76% |
RefSeq | Populus trichocarpa | XP_002320989.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKJ9
Fln msg: Distance to subject end: 202 aas, your sequence is shorter than subject: 52 - 546
Fln protein:
L
Protein Length:
53
Fln nts:
C
Fln Alignment:
F7JJN6E01BDCB0___LATYLE*NGGSLLTFEALAEAASFSRIWVPFCRKHSIEPRNPESYFSLKRDF
B8LKJ9_______________VSCYVSDDGAAMLTFETMSETAEFARKWVPFCKNFNIEPRAPEFYFSLKVDY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain