UniGene Name: sp_v3.0_unigene60157
Length: 176 nt
UniGene Fasta |
---|
>sp_v3.0_unigene60157
G |
Ace file of the UniGene sp_v3.0_unigene60157 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cinnamoyl CoA reductase isoform 1 n=6 Tax=Brassicaceae RepID=Q9FPM0_ARATH | - | - | 2.0e-16 | 78% |
FL-Next | tr=Cinnamoyl-CoA reductase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 73% |
Sma3 | Cinnamoyl-CoA reductase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cinnamoyl-CoA reductase. | EC:1.2.1.44 | - | 3.24401e-41 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 3.24401e-41 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.24401e-41 | % | |
Sma3 | Metabolic pathways | 01100 | 3.24401e-41 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.24401e-41 | % |
Source | Gene names |
---|---|
Sma3 | AT1G15950; At1g15950; At1g80820; CCR; CCR1; CCR2; CCR3; CCR4; CCR5; CCR6; CCR7; F23A5.17; GSVIVT00033763001; OJ1297_C09.8; OJ1352_A10.23; OSJNBa0004B13.15; Os01g0283700; Os02g0180700; Os08g0441500; Os09g0127300; Os09g0419200; OsI_01433; OsI_01435; OsI_061 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | 3-beta-hydroxy-delta5-steroid dehydrogenase activity | GO:0003854 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | cinnamoyl-CoA reductase activity | GO:0016621 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | steroid biosynthetic process | GO:0006694 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
Sma3 | 3-beta hydroxysteroid dehydrogenase/isomerase | IPR002225 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G15950.1 | CCR1, IRX4, ATCCR1 cinnamoyl coa reductase 1 chr1:5478855-5481915 FORWARD LENGTH=344 | 9.0e-23 | 78% |
RefSeq | Arabidopsis thaliana | NP_001077544.1 | cinnamoyl coa reductase 1 [Arabidopsis thaliana] | 1.0e-22 | 78% |
RefSeq | Populus trichocarpa | XP_002299259.1 | cinnamoyl CoA reductase, partial [Populus trichocarpa] | 7.0e-20 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q8VZH7
Fln msg: Distance to subject end: 148 aas, your sequence is shorter than subject: 58 - 324
Fln protein:
R
Protein Length:
59
Fln nts:
G
Fln Alignment:
F7JJN6E01AP7BZ___KRVVVTSSIGAVYMDPHRDPLAIVDDDCWSDLDYCMQTKNWYCYAK
Q8VZH7_______________RRVVFTSSIGAVYMDPSRDYDALVDENCWSNLDYCKETKNWYCYGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain