UniGene Name: sp_v3.0_unigene59878
Length: 222 nt
![]() |
---|
>sp_v3.0_unigene59878
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Disease resistance protein; pekinensis). | - | - | 0.0 | 54% |
Source | Gene names |
---|---|
Sma3 | LOC_Os11g06400; LOC_Os11g35200; LOC_Os11g45920; OSJNBa0054D14.1; OSJNBb0062H02.17; Os11g0686400; rt; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | DNA-binding WRKY | IPR003657 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D1GEG7
Fln msg: Distance to subject end: 589 aas, your sequence is shorter than subject: 73 - 2726
Fln protein:
I
Protein Length:
74
Fln nts:
A
Fln Alignment:
F7QVD2L01C7YR5___MSNALVLAALDFSSPFVIECDASCFGIGAMLMQDGHPITFESRKLNKRECLKSIYKKEMLAIMHALAKWMQY
D1GEG7_______________MVEAPVLALPNFEKPFVIESDASGFGVGAVLMQDGKPIAFFSHGLTEREQLKPAYERELMAVVLAVQKWKHY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain