UniGene Name: sp_v3.0_unigene59863
Length: 176 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene59863
G |
Ace file of the UniGene sp_v3.0_unigene59863
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding protein, putative (EC:1.3.1.74) | - | - | 9.0e-12 | 69% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
| Sma3 | Putative Receptor-like serine/threonine kinase(RFK1) | - | - | 1.841e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00031536001; GSVIVT00031541001; GSVIVT00031542001; GSVIVT00032664001; H0525G02.10; H0525G02.11; H0525G02.12; H0818E11.1; OJ1014_H11.17-1; OJ1014_H11.8; OJ1114_D06.122; OSJNBa0073I05.151; OSJNBa0093O08.1; OSJNBa0093O08.2; OSJNBa0093O08.3; OSJNBa0093O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Transcription regulator LuxR, C-terminal | IPR000792 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Sma3 | SKG6/AXL2 alpha-helix transmembrane domain | IPR014805 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G56145.2 | - | 3.0e-12 | 56% |
| RefSeq | Arabidopsis thaliana | NP_564710.1 | Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 4.0e-12 | 56% |
| RefSeq | Populus trichocarpa | XP_002303698.1 | predicted protein [Populus trichocarpa] | 7.0e-16 | 63% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NS02
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 92 aas, your sequence is shorter than subject: 58 - 315
Fln protein:
K
Protein Length:
59
Fln nts:
G
Fln Alignment:
F7JJN6E01A79FH___NNLNGSLPPELGSLTALEQLYIDSAGVSGEIPSSFRNLKSLKILWASDN
A9NS02_______________NDLSGMIPPELGNLTNLEKLYIRSNQFSGEIPTTFSNLKKMRLFWASSN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta