|
||||||
|
UniGene Name: sp_v3.0_unigene59857
Length: 156 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene59857
C |
|
Ace file of the UniGene sp_v3.0_unigene59857
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Endo-1,4-beta-mannosidase protein 1 n=1 Tax=Prunus persica RepID=B2BMP9_PRUPE | - | - | 1.0e-13 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 48% |
| Sma3 | Chromosome chr18 scaffold_61, whole genome shotgun sequence | - | - | 1.35e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mannan endo-1,4-beta-mannosidase. | EC:3.2.1.78 | - | 3.735e-19 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fructose and mannose metabolism | 00051 | 3.735e-19 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g10900; At5g01930; At5g66460; GSVIVT00024894001; GSVIVT00032045001; GSVIVT00032046001; GSVIVT00032047001; GSVIVT00032048001; GSVIVT00032050001; GSVIVT00037513001; K1F13.12; LOC_Os05g25480; MA4_25J11.12; MAN1; MAN4; MAN5; MAN6; MAN7; OSJNBb0006B22.2; OS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | mannan endo-1,4-beta-mannosidase activity | GO:0016985 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 5 | IPR001547 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G66460.1 | MAN7, AtMAN7 Glycosyl hydrolase superfamily protein chr5:26538911-26540837 REVERSE LENGTH=431 | 4.0e-18 | 63% |
| RefSeq | Arabidopsis thaliana | NP_201447.1 | mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana] | 5.0e-18 | 63% |
| RefSeq | Populus trichocarpa | XP_002306881.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9Z9
Fln msg: Distance to subject end: 322 aas, your sequence is shorter than subject: 51 - 429
Fln protein:
I
Protein Length:
52
Fln nts:
C
Fln Alignment:
F7JJN6E01CKDP8___GFNSYWLMTLATDPTQRNKVTSVFEQATAHGLNVARTWAFNDGQYKALQ
D5A9Z9_______________GWNSYWLMDQSVGDSTRHRVKTMLRRGAEMGLTVVRTWAFNDGGYNALQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
