UniGene Name: sp_v3.0_unigene59745
Length: 167 nt
![]() |
---|
>sp_v3.0_unigene59745
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Probable monodehydroascorbate reductase, cytoplasmic isoform 2 n=2 Tax=Arabidopsis RepID=MDAR2_ARATH | - | - | 1.0e-14 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | Monodehydroascorbate reductase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Monodehydroascorbate reductase (NADH). | EC:1.6.5.4 | - | 4.673e-29 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 4.673e-29 | % | |
Sma3 | Metabolic pathways | 01100 | 4.673e-29 | % |
Source | Gene names |
---|---|
Sma3 | 49D11.20a; 49D11.20b; AFRR; AT3G52880; At3g27820; At3g52880; At5g03630; BO-MDAR 2; F17C15_50; F8J2_50; GSVIVT00002544001; GSVIVT00020720001; GSVIVT00021644001; K16N12.2; MDAR; MDHAR1; Mdhar1; Mdhar2; Mdhar3; OJ1150_A11.25; OJ1155_H10.27; OJ1349_D05.106; O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | peroxisomal membrane | GO:0005778 | Cellular Component | 0.0 | - |
Sma3 | peroxisomal matrix | GO:0005782 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | monodehydroascorbate reductase (NADH) activity | GO:0016656 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
Sma3 | Protein BYPASS-related | IPR008511 | - | 0.0 | - |
Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G27820.1 | ATMDAR4, MDAR4 monodehydroascorbate reductase 4 chr3:10315249-10317881 FORWARD LENGTH=488 | 5.0e-20 | 78% |
RefSeq | Arabidopsis thaliana | NP_189420.1 | monodehydroascorbate reductase (NADH) [Arabidopsis thaliana] | 7.0e-20 | 78% |
RefSeq | Populus trichocarpa | XP_002298535.1 | predicted protein [Populus trichocarpa] | 8.0e-20 | 78% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PQT8
Fln msg: Distance to subject end: 382 aas, your sequence is shorter than subject: 51 - 434
Fln protein:
M
Protein Length:
52
Fln nts:
T
Fln Alignment:
F7JJN6E01AUPM0___FDYVILGGGVCAGYAAREFVNHGINHGELCIISAETVAPYERPALSK
C0PQT8_______________FKYVIVGGGVAAGYAAREFVKLGLKSGELAIISKEAVAPYERPALSK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain