UniGene Name: sp_v3.0_unigene59688
Length: 214 nt
![]() |
---|
>sp_v3.0_unigene59688
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide (PPR) repeat-containing protein | - | - | 2.0e-18 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
Sma3 | Tetratricopeptide-like helical | - | - | 5.242e-15 | - |
Source | Gene names |
---|---|
Sma3 | At1g09410; At1g11290; At1g15510; At1g20230; At1g56690; At1g74600; At2g13600; At2g22070; At2g29760; At3g11460; At3g13770; At3g24000; At3g46790; At3g49140; At4g02750; At4g21300; At4g30700; At5g04780; At5g06540; At5g15300; At5g39350; At5g40410; At5g44230; B1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09410.1 | pentatricopeptide (PPR) repeat-containing protein chr1:3035443-3037560 FORWARD LENGTH=705 | 1.0e-23 | 60% |
RefSeq | Arabidopsis thaliana | NP_172412.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-23 | 60% |
RefSeq | Populus trichocarpa | XP_002309422.1 | predicted protein [Populus trichocarpa] | 4.0e-23 | 59% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 159 aas, your sequence is shorter than subject: 70 - 795
Fln protein:
G
Protein Length:
71
Fln nts:
A
Fln Alignment:
F7JJN6E01CO09Z___VDLLGRAGRLNEARHFIETMHIQPSAGVWGSLLGACRIYCHIELAEYAARHLFELEPENSGFYILLSNI
B8LQA8_______________VDLLGRAGHLDEANGIIKNMSLEPDANVWGALLGACRIHCNIELGEQAAKHLFELDPDNAGYYVLLSNI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain