UniGene Name: sp_v3.0_unigene59685
Length: 216 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene59685
A |
Ace file of the UniGene sp_v3.0_unigene59685
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Auxin efflux carrier component n=4 Tax=Populus RepID=B9IHP8_POPTR | - | - | 2.0e-31 | 95% |
| FL-Next | tr=PIN-like auxin efflux carrier; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 86% |
| Sma3 | Auxin efflux carrier component | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | AEC1; AEC2; AEC3; AEH1; AEH2; AGR; AGR1; AT1G23080; At1g23080; At1g70940; At1g77110; At2g01420; At5g15100; At5g16530; At5g57090; CS-PIN1; EIR1; F15H11.14; F22K20.18; F2G14_220; F2I9.4; GSVIVT00014302001; GSVIVT00017824001; GSVIVT00020886001; GSVIVT0002325 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | lytic vacuole | GO:0000323 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | auxin efflux carrier complex | GO:0009921 | Cellular Component | 0.0 | - |
| Sma3 | basal plasma membrane | GO:0009925 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | vesicle membrane | GO:0012506 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | lateral plasma membrane | GO:0016328 | Cellular Component | 0.0 | - |
| Sma3 | apical part of cell | GO:0045177 | Cellular Component | 0.0 | - |
| Sma3 | auxin efflux transmembrane transporter activity | GO:0010329 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
| Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
| Sma3 | positive gravitropism | GO:0009958 | Biological Process | 0.0 | - |
| Sma3 | regulation of root meristem growth | GO:0010082 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | root hair initiation | GO:0048766 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
| Sma3 | Mpp10 protein | IPR007151 | - | 0.0 | - |
| Sma3 | Auxin efflux carrier, plant type | IPR014024 | - | 0.0 | - |
| Sma3 | Superoxide dismutase, copper/zinc, binding site | IPR018152 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G70940.1 | PIN3, ATPIN3 Auxin efflux carrier family protein chr1:26743170-26745871 FORWARD LENGTH=640 | 1.0e-38 | 91% |
| RefSeq | Arabidopsis thaliana | NP_177250.1 | auxin efflux carrier component 3 [Arabidopsis thaliana] | 2.0e-38 | 91% |
| RefSeq | Populus trichocarpa | XP_002322614.1 | auxin efflux carrier component [Populus trichocarpa] | 1.0e-39 | 95% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B5TXD0
Fln msg: Distance to subject end: 625 aas, atg_distance in limit (1-15): atg_distance = 3, W2: There is no M at the beginning, your sequence is shorter than subject: 71 - 699
Fln protein:
W
Protein Length:
72
Fln nts:
_
Fln Alignment:
F7JJN6E01CO8OL___DIYNVLSAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFISTNNPYAMNLRFIA
B5TXD0_______________DLYNVLVAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFISSNDPYTMNFKFIA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta