UniGene Name: sp_v3.0_unigene59658
Length: 238 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene59658
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ubiquitin carboxyl-terminal hydrolase [Arabidopsis thaliana] | - | - | 2.0e-27 | 81% |
FL-Next | Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 12 OS=Arabidopsis thaliana GN=UBP12 | - | - | 0.0 | 81% |
Sma3 | Ubiquitin carboxyl-terminal hydrolase, putative | - | - | 9.059e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin thiolesterase. | EC:3.1.2.15 | - | 1.996e-16 | - |
Source | Gene names |
---|---|
Sma3 | At3g11910; At5g06600; CM0545.290.nc; F15M7.13; F26K24.20; GSVIVT00002647001; GSVIVT00017456001; GSVIVT00027113001; LOC_Os11g36470; LOC_Os12g30540; MEC18.1; Os01g0771400; Os07g0163800; Os11g0573000; OsI_03906; OsI_25004; OsI_36553; OsI_38365; OsJ_03614; Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | double-stranded DNA binding | GO:0003690 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, GATA-type | IPR000679 | - | 0.0 | - |
Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 | IPR001394 | - | 0.0 | - |
Sma3 | MATH | IPR002083 | - | 0.0 | - |
Sma3 | Tify | IPR010399 | - | 0.0 | - |
Sma3 | CCT domain | IPR010402 | - | 0.0 | - |
Sma3 | TRAF-type | IPR013322 | - | 0.0 | - |
Sma3 | Small acid-soluble spore protein, alpha/beta-type, conserved site | IPR018126 | - | 0.0 | - |
Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site | IPR018200 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G06600.1 | UBP12 ubiquitin-specific protease 12 chr5:2019545-2027834 REVERSE LENGTH=1116 | 1.0e-30 | 81% |
RefSeq | Arabidopsis thaliana | NP_001119179.1 | ubiquitin carboxyl-terminal hydrolase 12 [Arabidopsis thaliana] | 1.0e-30 | 81% |
RefSeq | Populus trichocarpa | XP_002316470.1 | predicted protein [Populus trichocarpa] | 2.0e-31 | 83% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FPT1-2
Fln msg: Distance to subject end: 189 aas, your sequence is shorter than subject: 79 - 1115
Fln protein:
S
Protein Length:
80
Fln nts:
C
Fln Alignment:
F7QVD2L01ARSXU___PIKHRGVDHLSDMLVHYNQISDILYYEVLDIPLSELQGLKSLKVTFHHAMKDEISVHVIRLPKHST
Q9FPT1-2_____________PIKYRGVDHLSDMLVHYNQTSDILYYEVLDIPLPELQGLKTLKVAFHHATKEEVVIHNIRLPKQST
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain