|
||||||
|
UniGene Name: sp_v3.0_unigene59650
Length: 151 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene59650
A |
|
Ace file of the UniGene sp_v3.0_unigene59650
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Steroid 5-alpha reductase n=4 Tax=Papilionoideae RepID=Q8GTD7_CICAR | - | - | 2.0e-18 | 88% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | Trans-2-enoyl-CoA reductase | - | - | 4.755e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 3-oxo-5-alpha-steroid 4-dehydrogenase. | EC:1.3.99.5 | - | 1.427e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Steroid hormone biosynthesis | 00140 | 1.427e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g55360; ECR1; ECR2; GSVIVT00018488001; OSTLU_49170; Os01g0150000; OsI_00410; OsJ_00385; Ot03g04010; P0009G03.2-1; P0434B04.35-1; PHYPADRAFT_203665; PHYPADRAFT_57093; PHYPADRAFT_67731; POPTRDRAFT_720621; POPTRDRAFT_822481; RCOM_1206840; T22E16.2; T22E16 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | fatty acid elongase complex | GO:0009923 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | 3-oxo-5-alpha-steroid 4-dehydrogenase activity | GO:0003865 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid elongase activity | GO:0009922 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the CH-CH group of donors | GO:0016627 | Molecular Function | 0.0 | - |
| Sma3 | trans-2-enoyl-CoA reductase (NADPH) activity | GO:0019166 | Molecular Function | 0.0 | - |
| Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | sphingolipid metabolic process | GO:0006665 | Biological Process | 0.0 | - |
| Sma3 | wax biosynthetic process | GO:0010025 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
| Sma3 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal | IPR001104 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G55360.1 | CER10, ECR, ATTSC13, TSC13 3-oxo-5-alpha-steroid 4-dehydrogenase family protein chr3:20521186-20522856 REVERSE LENGTH=310 | 2.0e-23 | 84% |
| RefSeq | Arabidopsis thaliana | NP_191096.1 | enoyl reductase [Arabidopsis thaliana] | 2.0e-23 | 84% |
| RefSeq | Populus trichocarpa | XP_002311166.1 | predicted protein [Populus trichocarpa] | 8.0e-25 | 92% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0I4
Fln msg: Distance to subject end: 35 aas, your sequence is shorter than subject: 49 - 308
Fln protein:
G
Protein Length:
50
Fln nts:
A
Fln Alignment:
F7QVD2L01A4D6P___GKGGYQIPSGFLFNIVTCANYTTEIYQWLGFNIATQTV-GYIFLVVATFI
A9P0I4_______________GKGGYQIPGGFLFNIVTCANYTTEIYQWLGFNIATQTVAGYTFLAVATFI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
