UniGene Name: sp_v3.0_unigene59575
Length: 215 nt
![]() |
---|
>sp_v3.0_unigene59575
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Retrotransposon protein, putative, unclassified n=1 Tax=Oryza sativa Japonica Group RepID=Q2QLN6_ORYSJ | - | - | 4.0e-15 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Retrotransposon protein, putative, unclassified | - | - | 5.652e-24 | - |
Source | Gene names |
---|---|
Sma3 | F23H6.1; H0124B04.16; H0321H01.8; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g07050; LOC_Os03g10000; LOC_Os03g13350; LOC_Os03g26020; LOC_Os03g61190; LOC_Os10g06110; LOC_Os10g13960; LOC_Os10g16880; LOC_Os10g28310; LOC_Os10g37610; LOC_Os10g4040 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
![]() |
---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: STOP codon was not found. Distance to subject end: 6 aas, Unexpected STOP codon in 5 prime region,
Fln protein:
Y
Protein Length:
66
Fln nts:
T
Fln Alignment:
F7QVD2L01DDWXO___RIDHGT---CLDYGELNMLTIKDKFPIPVIDELFDELYGAIYFTKLDLHSRYHQIRM
A9NWN2_______________RINDGSYILCNNCRVLNEITIKDKFHISIVDELLDELYGTMYFLELDQKSNYYHIRV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain