UniGene Name: sp_v3.0_unigene59528
Length: 219 nt
UniGene Fasta |
---|
>sp_v3.0_unigene59528
A |
Ace file of the UniGene sp_v3.0_unigene59528 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=2 Tax=Oryza sativa Japonica Group RepID=Q851Y3_ORYSJ | - | - | 8.0e-20 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Source | Gene names |
---|---|
Sma3 | AT4g10990; At2g16000; B0809H07.1; F25I24.200; F8M12.17; LOC_Os03g25890; LOC_Os10g34290; LOC_Os11g35630; LOC_Os11g37710; LOC_Os11g44780; OSIGBa0153E02-OSIGBa0093I20.3; OSJNBa0012L23.58; OSJNBa0015N08.18; OSJNBa0088I22.18; OSJNBa0090L05.1; OSJNBb0011N17.2; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | oxygen evolving complex | GO:0009654 | Cellular Component | 0.0 | - |
Sma3 | extrinsic to membrane | GO:0019898 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 3.0e-19 | 47% |
RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 3.0e-19 | 47% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 278 aas, atg_distance in limit (1-15): atg_distance = 13, your sequence is shorter than subject: 73 - 363
Fln protein:
M
Protein Length:
74
Fln nts:
_
Fln Alignment:
F7QVD2L01D5PTX___DLVPLPKGRKLVRCKWVYRTKFGPDGKVVKHKARLVAKGFSQVEGIDYTKTFSPIAKMNSIHLVLSLAA
B8LKV8_______________DLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain