|
||||||
|
UniGene Name: sp_v3.0_unigene59359
Length: 224 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene59359
A |
|
Ace file of the UniGene sp_v3.0_unigene59359
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Polyprotein, putative (Fragment) n=1 Tax=Solanum tuberosum RepID=Q0KIJ4_SOLTU | - | - | 2.0e-18 | 66% |
| FL-Next | tr=OSJNBa0014F04.5 protein; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 61% |
| Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | B1159F04.11; B1160F02.3; B1160F02.4; B1292H11.7; H0124E07.7; H0124E07.8; H0211F06-OSIGBa0153M17.10; H0211F06-OSIGBa0153M17.12; H0502G05.10; H0616A11.2; H0624F09.1; H0807C06-H0308C08.9; H0818H01.18; LOC_Os03g15160; LOC_Os03g15450; LOC_Os03g23180; LOC_Os03g |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q7XR42
Fln msg: Distance to subject end: 185 aas, your sequence is shorter than subject: 74 - 394
Fln protein:
G
Protein Length:
75
Fln nts:
A
Fln Alignment:
F7JJN6E01BDAJL___RVNQVLEDMLRMYVMDQQNQWEKYLPLVEFAYNNSYHSSIQAAPFEILYGRPCHTPLSWDRL
Q7XR42_______________RVNQILEDMLRAYALDFGGAWDKSLPYAEFSYNNSYQTNLQMAPFEVLYGRKCRTPLFWDQI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
