SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene59160

Length: 225 nt

UniGene Fasta

>sp_v3.0_unigene59160
ATGGGGATGCACATACCGGAAAACATATTTTCCAAGAATGCATACTTGGTATTCTGGGTTCAAAGACCGTAGTCTATGTAACTCATCAAGTGGAGTTTTTACCCTCTGCTGACATCATTCTGGTAATGCGAGATGGTGAAATTACTCAGGTTGGCAGATATCATGACATCTTACAATCAGGCACAGATTTTTGNGGAATTAGTTGGTGCACATCAGAAAGCTTTG

Ace file of the UniGene sp_v3.0_unigene59160

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	MRP-like ABC transporter [Arabidopsis thaliana]	-	-	3.0e-21	70%
FL-Next	sp=ABC transporter C family member 6; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	72%
Sma3	Multidrug resistance protein ABC transporter family	-	-	1.861e-18	-

Source	ECs	Term	Type	e value	Identity
Sma3	Xenobiotic-transporting ATPase.	EC:3.6.3.44	-	5.306e-14	-

Source	Gene names
Sma3	At1g04120; At1g71330; At3g13080; At3g13090; At3g13100; B1065G12.13; B1157F09.14; EST2; F20D22.11; F3I17.2; FeMRP3; GSVIVT00011051001; GSVIVT00018959001; GSVIVT00027983001; GSVIVT00028494001; GSVIVT00033319001; GSVIVT00033321001; GSVIVT00033327001; GSVIVT0

Source	GOs	Term	Type	Identity
Sma3	plant-type vacuole	GO:0000325	Cellular Component	-
Sma3	vacuolar membrane	GO:0005774	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sulfonylurea receptor activity	GO:0008281	Molecular Function	-
Sma3	xenobiotic-transporting ATPase activity	GO:0008559	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	chlorophyll catabolite transmembrane transporter activity	GO:0010290	Molecular Function	-
Sma3	protein disulfide oxidoreductase activity	GO:0015035	Molecular Function	-
Sma3	glutathione S-conjugate-exporting ATPase activity	GO:0015431	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of substances	GO:0042626	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	cellular potassium ion homeostasis	GO:0030007	Biological Process	-
Sma3	cell redox homeostasis	GO:0045454	Biological Process	-
Sma3	response to other organism	GO:0051707	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ABC transporter, transmembrane domain	IPR001140	-	-
Sma3	Glutaredoxin	IPR002109	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	K Homology domain	IPR004087	-	-
Sma3	K Homology domain, type 1	IPR004088	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-
Sma3		IPR018111	-	-
Sma3	Ribosomal protein S2, conserved site	IPR018130	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G13090.1	ATMRP8, ABCC6, MRP8 multidrug resistance-associated protein 8 chr3:4203013-4208171 REVERSE LENGTH=1466	2.0e-26	72%
RefSeq	Arabidopsis thaliana	NP_187916.3	multidrug resistance-associated protein 8 [Arabidopsis thaliana]	3.0e-26	72%
RefSeq	Populus trichocarpa	XP_002300362.1	multidrug resistance protein ABC transporter family [Populus trichocarpa]	4.0e-26	72%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q8VZZ4

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 637 aas, your sequence is shorter than subject: 64 - 1466

Fln protein: GDAHTGKHIFQECILGILGSKTVVYVTHQVEFLPSADIILVMRDGEITQVGRYHDILQSGTDF*

Protein Length: 65

Fln nts: ATGGGGATGCACATACCGGAAAACATATTTTCCAAGAATGCATACTTGGTATTCTGGGTTCAAAGACCGTAGTCTATGTAACTCATCAAGTGGAGTTTTTACCCTCTGCTGACATCATTCTGGTAATGCGAGATGGTGAAATTACTCAGGTTGGCAGATATCATGACATCTTACAATCAGGCACAGATTTTTGaGGAATTAGTTGGTGCACATCAGAAAGCTTTG

Fln Alignment:

F7JJN6E01DKK55___DAHTGKHIFQECILGILGSKTVVYVTHQVEFLPSADIILVMRDGEITQVGRYHDILQSGTDF
Q8VZZ4_______________DAHTGSHLFKEVLLGLLRHKTVIYVTHQVEFLPEADLILVMKDGKITQAGKYHEILDSGTDF

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain