UniGene Name: sp_v3.0_unigene59160
Length: 225 nt
![]() |
---|
>sp_v3.0_unigene59160
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | MRP-like ABC transporter [Arabidopsis thaliana] | - | - | 3.0e-21 | 70% |
FL-Next | sp=ABC transporter C family member 6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
Sma3 | Multidrug resistance protein ABC transporter family | - | - | 1.861e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 5.306e-14 | - |
Source | Gene names |
---|---|
Sma3 | At1g04120; At1g71330; At3g13080; At3g13090; At3g13100; B1065G12.13; B1157F09.14; EST2; F20D22.11; F3I17.2; FeMRP3; GSVIVT00011051001; GSVIVT00018959001; GSVIVT00027983001; GSVIVT00028494001; GSVIVT00033319001; GSVIVT00033321001; GSVIVT00033327001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
Sma3 | Glutaredoxin | IPR002109 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
Sma3 | IPR018111 | - | 0.0 | - | |
Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G13090.1 | ATMRP8, ABCC6, MRP8 multidrug resistance-associated protein 8 chr3:4203013-4208171 REVERSE LENGTH=1466 | 2.0e-26 | 72% |
RefSeq | Arabidopsis thaliana | NP_187916.3 | multidrug resistance-associated protein 8 [Arabidopsis thaliana] | 3.0e-26 | 72% |
RefSeq | Populus trichocarpa | XP_002300362.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 4.0e-26 | 72% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8VZZ4
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 637 aas, your sequence is shorter than subject: 64 - 1466
Fln protein:
G
Protein Length:
65
Fln nts:
A
Fln Alignment:
F7JJN6E01DKK55___DAHTGKHIFQECILGILGSKTVVYVTHQVEFLPSADIILVMRDGEITQVGRYHDILQSGTDF
Q8VZZ4_______________DAHTGSHLFKEVLLGLLRHKTVIYVTHQVEFLPEADLILVMKDGKITQAGKYHEILDSGTDF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain