|
||||||
|
UniGene Name: sp_v3.0_unigene59117
Length: 169 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene59117
A |
|
Ace file of the UniGene sp_v3.0_unigene59117 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum | - | - | 1.0e-17 | 56% |
| FL-Next | sp=Probable LRR receptor-like serine/threonine-protein kinase At1g56140; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 64% |
| Sma3 | Putative Receptor-like serine/threonine kinase(RFK1) | - | - | 1.629e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G56145; At1g56140; At1g56145; F14G9.24; F14G9.25; GSVIVT00031536001; GSVIVT00031537001; GSVIVT00031542001; GSVIVT00031548001; GSVIVT00035223001; GSVIVT00035234001; GSVIVT00035252001; GSVIVT00035539001; GSVIVT00035559001; H0525G02.10; H0525G02.11; H0525 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Chaperonin TCP-1, conserved site | IPR002194 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Glycoprotein D/GG/GX, Herpesvirus | IPR002896 | - | 0.0 | - |
| Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Sma3 | SKG6/AXL2 alpha-helix transmembrane domain | IPR014805 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G56120.1 | Leucine-rich repeat transmembrane protein kinase chr1:20987288-20993072 REVERSE LENGTH=1047 | 3.0e-19 | 68% |
| RefSeq | Arabidopsis thaliana | NP_176008.4 | Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 4.0e-19 | 68% |
| RefSeq | Populus trichocarpa | XP_002324865.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: C0LGH3
Fln msg: Distance to subject end: 425 aas, your sequence is shorter than subject: 56 - 1033
Fln protein:
T
Protein Length:
57
Fln nts:
A
Fln Alignment:
F7QVD2L01B0G9W___DFDIRKEAGGSNI-AVVKSFKTNVTANFLEIHFFWTGKGTCCIPIQGTYGP
C0LGH3_______________DFDVRRTAGDSTVRAVQREYKANVSQNHLEIHLFWAGKGTCCIPIQGAYGP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
