|
||||||
|
UniGene Name: sp_v3.0_unigene58960
Length: 169 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene58960
T |
|
Ace file of the UniGene sp_v3.0_unigene58960 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP-binding cassette transporter, subfamily C, member 5, SmABCC5 n=2 Tax=Selaginella moellendorffii RepID=D8REF1_SELML | - | - | 1.0e-11 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
| Sma3 | Multidrug resistance-associated protein 2, 6 (Mrp2, 6), abc-transoprter, putative | - | - | 2.033e-23 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.713e-27 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04120; At3g13080; At3g13090; At3g13100; At3g21250; At3g60160; At3g60970; B1065G12.13; EST2; F20D22.11; GSVIVT00011076001; GSVIVT00018959001; GSVIVT00028470001; GSVIVT00028471001; GSVIVT00028494001; GSVIVT00033319001; GSVIVT00033321001; GSVIVT000333300 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
| Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G04120.1 | ATMRP5, MRP5, ATABCC5, ABCC5 multidrug resistance-associated protein 5 chr1:1064848-1070396 REVERSE LENGTH=1514 | 5.0e-15 | 66% |
| RefSeq | Arabidopsis thaliana | NP_001184906.1 | ABC transporter C family member 5 [Arabidopsis thaliana] | 6.0e-15 | 66% |
| RefSeq | Populus trichocarpa | XP_002301842.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 2.0e-15 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NSU0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 34 aas, your sequence is shorter than subject: 43 - 131
Fln protein:
R
Protein Length:
44
Fln nts:
T
Fln Alignment:
F7JJN6E01AWDJB___RILVDDEATASVDTATDGFIQQIIRHQFYTCTVITIAHRIPY*RK*DMVLLLKDGQ
A9NSU0_______________RILVLDEATASIDSATDALLQKVIRHEFSNCTVITIAHRVPTVIDSDMVLTLSDGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
