UniGene Name: sp_v3.0_unigene58947
Length: 198 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene58947
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative gag-pol polyprotein, identical n=1 Tax=Solanum demissum RepID=Q6L3N8_SOLDE | - | - | 2.0e-14 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | 60I2G14; AT4g17450; B1110B01.13; BA4; F11I4_21; F28G4.2; H0211A12.10; H0716A07.9; LOC_Os03g02500; LOC_Os03g11850; LOC_Os03g14060; LOC_Os03g14349; LOC_Os03g21050; LOC_Os03g21419; LOC_Os03g29130; LOC_Os03g30450; LOC_Os03g31134; LOC_Os03g31200; LOC_Os03g3364 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | CCAAT-binding factor complex | GO:0016602 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 2.0e-15 | 50% |
RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 2.0e-15 | 50% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 260 aas, your sequence is shorter than subject: 50 - 363
Fln protein:
A
Protein Length:
51
Fln nts:
T
Fln Alignment:
F7JJN6E01C3W0T___ADGSIEKLKARLIAKGYSQ*EGIDFDDTFAPVAKLNTIRMLISLATXXXXXXXXLDVKSTFLNG
B8LKV8_______________ANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain