|
||||||
|
UniGene Name: sp_v3.0_unigene58859
Length: 243 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene58859
T |
|
Ace file of the UniGene sp_v3.0_unigene58859 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MATE efflux family protein [Arabidopsis thaliana] gb|AAD46034.1|AC007519_19 F16N3.20 [Arabidopsis thaliana] gb|AEE32181.1| MATE efflux family protein [Arabidopsis thaliana] | - | - | 2.0e-24 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
| Sma3 | Multidrug resistance pump, putative | - | - | 8.071e-34 | - |
| Source | Gene names |
|---|---|
| Sma3 | 117M18_21; 117M18_23; AT4G21910; AT4g00350; AT4g21910; AT4g25640; A_IG005I10.20; At1g12950; At1g33080; At1g33110; At1g47530; At3g21690; At3g26590; At4g21910; At4g25640; At5g10420; At5g38030; At5g44050; At5g65380; DDTFR18; F12B17_230; F16N3.20; F5I10.20; F |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | - |
| Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosome-binding factor A | IPR000238 | - | 0.0 | - |
| Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Peptidase M1, alanine aminopeptidase/leukotriene A4 hydrolase | IPR001930 | - | 0.0 | - |
| Sma3 | Multi antimicrobial extrusion protein | IPR002528 | - | 0.0 | - |
| Sma3 | Peptidase M1, alanyl aminopeptidase | IPR012779 | - | 0.0 | - |
| Sma3 | Peptidase M1, membrane alanine aminopeptidase, N-terminal | IPR014782 | - | 0.0 | - |
| Sma3 | IPR015521 | - | 0.0 | - | |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I25, cystatin, conserved site | IPR018073 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G47530.1 | MATE efflux family protein chr1:17451724-17454110 FORWARD LENGTH=484 | 4.0e-31 | 75% |
| RefSeq | Arabidopsis thaliana | NP_175184.1 | MATE efflux family protein [Arabidopsis thaliana] | 5.0e-31 | 75% |
| RefSeq | Populus trichocarpa | XP_002329229.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-32 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKL5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 351 aas, your sequence is shorter than subject: 74 - 500
Fln protein:
C
Protein Length:
75
Fln nts:
T
Fln Alignment:
F7JJN6E01CHCBT___CQYSLGAITQTFAGHLGTIELAAVAIENSVIAGLAFGTMLGMGSALETLCGQAFGAGQIHMLGVYMQEGTI
B8LKL5_______________CQYSLGALTQTFAGHIGELELAAVSIENSVIAGLSFGIMMGMGSALETLCGQSVGARRLDLLGLYMQRSWI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
