UniGene Name: sp_v3.0_unigene58855
Length: 184 nt
UniGene Fasta |
---|
>sp_v3.0_unigene58855
A |
Ace file of the UniGene sp_v3.0_unigene58855 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Translationally-controlled tumor protein homolog n=4 Tax=Pinaceae RepID=TCTP_PSEMZ | - | - | 1.0e-14 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Sma3 | Translationally-controlled tumor protein homolog | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At3g05540; At3g16640; F18C1.20; GSVIVT00019752001; GSVIVT00022720001; MGL6.10; Os11g0660500; OsI_36917; OsJ_34729; PHYPADRAFT_205346; PHYPADRAFT_71619; POPTRDRAFT_725698; POPTRDRAFT_828031; POPTRDRAFT_828728; RCOM_0681260; RCOM_1433410; RsRG3-8; TCTP; TCT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | regulation of cell growth | GO:0001558 | Biological Process | 0.0 | - |
Sma3 | pollen tube growth | GO:0009860 | Biological Process | 0.0 | - |
Sma3 | auxin homeostasis | GO:0010252 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | lateral root development | GO:0048527 | Biological Process | 0.0 | - |
Sma3 | root hair cell tip growth | GO:0048768 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR001983 | - | 0.0 | - | |
Sma3 | Mss4/translationally controlled tumour-associated TCTP | IPR011323 | - | 0.0 | - |
Sma3 | Translationally controlled tumour protein, conserved site | IPR018103 | - | 0.0 | - |
Sma3 | Translationally controlled tumour protein | IPR018105 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G05540.1 | Methionine sulfoxide reductase (MSS4-like) family protein chr3:1606487-1608030 REVERSE LENGTH=168 | 2.0e-17 | 73% |
RefSeq | Arabidopsis thaliana | NP_187205.4 | Methionine sulfoxide reductase (MSS4-like) protein [Arabidopsis thaliana] | 2.0e-17 | 73% |
RefSeq | Populus trichocarpa | XP_002314382.1 | predicted protein [Populus trichocarpa] | 8.0e-17 | 73% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NPE8
Fln msg: Distance to subject end: 59 aas, your sequence is shorter than subject: 61 - 167
Fln protein:
W
Protein Length:
62
Fln nts:
A
Fln Alignment:
F7JJN6E01CH6QY___NQAAKVVDIVDTFRLQEQPSFDKKQFLAFIKRYIKNLNTKLSEERQAE
A9NPE8_______________DQAVKVVDIVDTFRLQEQPSFDKKQFLAFIKRYIKNLATKLTEERQAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain