UniGene Name: sp_v3.0_unigene58841
Length: 228 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene58841
G |
Ace file of the UniGene sp_v3.0_unigene58841
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | [RTKL] COG0515 Serine/threonine protein kinase | - | - | 2.0e-09 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
| Sma3 | Serine/threonine protein kinase, putative | - | - | 4.713e-26 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 1.738e-13 | - |
| Sma3 | Protein kinase C. | EC:2.7.11.13 | - | 1.201e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphatidylinositol signaling system | 04070 | 1.201e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | AGC1-10; AcNPH1; Adi3; At1g16440; At1g51170; At1g53700; At2g26700; At2g44830; At3g12690; At3g14370; At3g20830; At3g44610; At3g52890; At5g03640; At5g40030; At5g47750; At5g55910; B1026E06.38; B1066D09.24; B1279D09.7; B1394A07.1; BIF2; Bcpk1; CsPK3; F17C15_6 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
| Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
| Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | AGC-kinase, C-terminal | IPR000961 | - | 0.0 | - |
| Sma3 | Phytochrome | IPR001294 | - | 0.0 | - |
| Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
| Sma3 | Zinc finger, RanBP2-type | IPR001876 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Phytochrome, central region | IPR013515 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore binding site | IPR013516 | - | 0.0 | - |
| Sma3 | PAS fold-2 | IPR013654 | - | 0.0 | - |
| Sma3 | PAS fold-3 | IPR013655 | - | 0.0 | - |
| Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore attachment domain | IPR016132 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G13000.1 | AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein chr4:7598099-7599217 REVERSE LENGTH=372 | 8.0e-16 | 49% |
| RefSeq | Arabidopsis thaliana | NP_193036.1 | AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein [Arabidopsis thaliana] | 1.0e-15 | 49% |
| RefSeq | Populus trichocarpa | XP_002301811.1 | predicted protein [Populus trichocarpa] | 2.0e-14 | 52% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NPF9
Fln msg: Distance to subject end: 190 aas, your sequence is shorter than subject: 76 - 385
Fln protein:
A
Protein Length:
77
Fln nts:
G
Fln Alignment:
F7JJN6E01CYQ7W___ALEHLHGQGIVYRDLKPENVLVQSSGHIMLTDFDLSTRLPLPCKQLCASISQEKDQSNSQRPLRG
A9NPF9_______________ALEYLHQHGILYRDLKPENILLQADGHIMITDFDLS---------LMINNSQESRAKDSYRDQNG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta