|
||||||
|
UniGene Name: sp_v3.0_unigene58745
Length: 238 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene58745
T |
|
Ace file of the UniGene sp_v3.0_unigene58745
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative ubiquitin protease [Oryza sativa Indica Group] | - | - | 2.0e-18 | 60% |
| FL-Next | sp=Ubiquitin carboxyl-terminal hydrolase 13; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 61% |
| Sma3 | Ubiquitin carboxyl-terminal hydrolase, putative | - | - | 7.14e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin thiolesterase. | EC:3.1.2.15 | - | 1.294e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g11910; At5g06600; CM0545.290.nc; F15M7.13; F26K24.20; GSVIVT00002647001; GSVIVT00017456001; GSVIVT00027113001; LOC_Os11g36470; LOC_Os12g30540; MEC18.1; Os07g0163800; Os11g0573000; OsI_25004; OsI_36553; OsJ_23193; OsJ_34325; P0428D12.118; PHYPADRAFT_18 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | double-stranded DNA binding | GO:0003690 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Zinc finger, GATA-type | IPR000679 | - | 0.0 | - |
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 | IPR001394 | - | 0.0 | - |
| Sma3 | MATH | IPR002083 | - | 0.0 | - |
| Sma3 | Tify | IPR010399 | - | 0.0 | - |
| Sma3 | CCT domain | IPR010402 | - | 0.0 | - |
| Sma3 | TRAF-type | IPR013322 | - | 0.0 | - |
| Sma3 | Small acid-soluble spore protein, alpha/beta-type, conserved site | IPR018126 | - | 0.0 | - |
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site | IPR018200 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G11910.1 | UBP13 ubiquitin-specific protease 13 chr3:3761758-3770290 REVERSE LENGTH=1115 | 4.0e-23 | 61% |
| RefSeq | Arabidopsis thaliana | NP_001189864.1 | ubiquitin carboxyl-terminal hydrolase 13 [Arabidopsis thaliana] | 5.0e-23 | 61% |
| RefSeq | Populus trichocarpa | XP_002322753.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-27 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q84WU2
Fln msg: Distance to subject end: 21 aas, your sequence is shorter than subject: 78 - 1115
Fln protein:
N
Protein Length:
79
Fln nts:
T
Fln Alignment:
F5X2MQL01EGEAI___LAIHEGETLAV*VXXXXXXXXLHVPDEEFCKWNFAFISLGRPEYLQDADIVSTRFQKRDVYGAWEQYLGWSNSDSA
Q84WU2_______________LVIHEGETLEE--IKTRIQKKLHVPDEDFAKWKFASFSMGRPDYLLDTDVVYNRFQRRDVYGAWEQYLGLEHIDNA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
