UniGene Name: sp_v3.0_unigene58629
Length: 243 nt
![]() |
---|
>sp_v3.0_unigene58629
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | VTC2-like protein n=1 Tax=Nicotiana tabacum RepID=B3GK04_TOBAC | - | - | 4.0e-26 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | VTC2-like protein | - | - | 7.107e-14 | - |
Source | Gene names |
---|---|
Sma3 | AT4g26850; At4g26850; At5g55120; B1065G12.8; CHLREDRAFT_113717; F10M23.190; GSVIVT00022399001; GSVIVT00027274001; LOC_Os12g08810; Os01g0901300; Os12g0190000; OsI_04811; OsI_37726; OsJ_04435; OsJ_35472; PHYPADRAFT_166416; PHYPADRAFT_3338; POPTRDRAFT_552990 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | mannose-1-phosphate guanylyltransferase (GDP) activity | GO:0008928 | Molecular Function | 0.0 | - |
Sma3 | GDP-galactose:mannose-1-phosphate guanylyltransferase activity | GO:0010471 | Molecular Function | 0.0 | - |
Sma3 | GDP-galactose:glucose-1-phosphate guanylyltransferase activity | GO:0010472 | Molecular Function | 0.0 | - |
Sma3 | GDP-galactose:myoinositol-1-phosphate guanylyltransferase activity | GO:0010473 | Molecular Function | 0.0 | - |
Sma3 | glucose-1-phosphate guanylyltransferase (GDP) activity | GO:0010474 | Molecular Function | 0.0 | - |
Sma3 | galactose-1-phosphate guanylyltransferase (GDP) activity | GO:0010475 | Molecular Function | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
Sma3 | L-ascorbic acid biosynthetic process | GO:0019853 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Stigma-specific protein Stig1 | IPR006969 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G26850.1 | " VTC2 mannose-1-phosphate guanylyltransferase (GDP)s;GDP-galactose:mannose-1-phosphate guanylyltransferases;GDP-galactose:glucose-1-phosphate guanylyltransferases;GDP-galactose:myoinositol-1-phosphate guanylyltransferases;glucose-1-phosphate guanylyltra | 3.0e-30 | 69% |
RefSeq | Arabidopsis thaliana | NP_567759.1 | GDP-L-galactose phosphorylase [Arabidopsis thaliana] | 4.0e-30 | 69% |
RefSeq | Populus trichocarpa | XP_002302967.1 | predicted protein [Populus trichocarpa] | 7.0e-32 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LL93
Fln msg: Distance to subject end: 56 aas, your sequence is shorter than subject: 81 - 436
Fln protein:
I
Protein Length:
82
Fln nts:
A
Fln Alignment:
F5X2MQL01A0ERZ___IPYNVLIVSLVLWQKGFLFPQCYAEKQALGEVDQEILDTQVNPAVWEISGHIVLKRKQDFDRASEDYACKLLAEVSLSEER
B8LL93_______________IPYNVLIADC--GKRVFLFPQCYAEKQALGEVDQEILDTQVNPAVWEISGHIVLKRKQDFDRASEDYACKLLAEVSLSEER
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain