UniGene Name: sp_v3.0_unigene58540
Length: 225 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene58540
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=1 Tax=Solanum lycopersicum RepID=Q5GA69_SOLLC | - | - | 7.0e-18 | 69% |
FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 61% |
Sma3 | Reverse transcriptase-like protein | - | - | 2.538e-22 | - |
Source | Gene names |
---|---|
Sma3 | AT4g22040; At2g07010; At2g13940; At2g16670; At2g23330; At2g24660; F25P12.89; F28L22.3; H0306F03.15; H0413E07.4; LOC_Os03g46450; LOC_Os10g21080; LOC_Os10g34120; LOC_Os11g01090; LOC_Os11g05840; LOC_Os12g01090; LOC_Os12g23320; LOC_Os12g35810; LYC_68t000004; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | phosphopyruvate hydratase complex | GO:0000015 | Cellular Component | 0.0 | - |
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
Sma3 | nematocyst | GO:0042151 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | dihydrofolate reductase activity | GO:0004146 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
Sma3 | phosphopyruvate hydratase activity | GO:0004634 | Molecular Function | 0.0 | - |
Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | sodium channel inhibitor activity | GO:0019871 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | glycine biosynthetic process | GO:0006545 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | nucleotide biosynthetic process | GO:0009165 | Biological Process | 0.0 | - |
Sma3 | pathogenesis | GO:0009405 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 4.0e-13 | 55% |
RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 5.0e-13 | 55% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 302 aas, your sequence is shorter than subject: 75 - 542
Fln protein:
V
Protein Length:
76
Fln nts:
G
Fln Alignment:
F585NNT02H06W4___EVHQMDVKFAFLHGDLHEEIYMEQPIGF-IQTDSSLVCRIKKSLYGLKQAPRAWYAKMDSFL
Q9M5J7_______________EVEQMDVKTTFLHGDLEEEIYMKQPEGFVVKGNKELVCKINKSLCGVKQSPRMWYQKFDTYI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain