|
||||||
|
UniGene Name: sp_v3.0_unigene58528
Length: 221 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene58528
G |
|
Ace file of the UniGene sp_v3.0_unigene58528
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA topoisomerase 2 n=1 Tax=Nicotiana tabacum RepID=Q8GSC4_TOBAC | - | - | 4.0e-10 | 54% |
| FL-Next | sp=DNA topoisomerase 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 68% |
| Sma3 | DNA topoisomerase 2 | - | - | 4.921e-32 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA topoisomerase (ATP-hydrolyzing). | EC:5.99.1.3 | - | 6.257e-30 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g23890; F14O13.7; GSVIVT00028763001; Md49N23_TopII.010; Os02g0699700; OsI_08583; OsJ_08043; P0459B01.29; PHYPADRAFT_120620; PHYPADRAFT_134247; POPTRDRAFT_557797; POPTRDRAFT_706393; RCOM_0966810; TOP2; TopII; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
| Sma3 | DNA topoisomerase (ATP-hydrolyzing) activity | GO:0003918 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA topoisomerase, type IIA | IPR001241 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, subunit A/C-terminal | IPR002205 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, subunit B, domain 2 | IPR013506 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, subunit A, alpha-helical | IPR013757 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, subunit A/ C-terminal, alpha-beta | IPR013758 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, subunit B/N-terminal, alpha-beta | IPR013759 | - | 0.0 | - |
| Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G23890.1 | TOPII, ATTOPII topoisomerase II chr3:8624931-8631106 FORWARD LENGTH=1473 | 1.0e-12 | 68% |
| RefSeq | Arabidopsis thaliana | NP_001118686.1 | DNA topoisomerase 2 [Arabidopsis thaliana] | 1.0e-12 | 68% |
| RefSeq | Populus trichocarpa | XP_002314046.1 | predicted protein [Populus trichocarpa] | 5.0e-14 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P30182
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 544 aas, your sequence is shorter than subject: 73 - 1473
Fln protein:
G
Protein Length:
74
Fln nts:
G
Fln Alignment:
F585NNT02JDSET___PMTPWYKGFKGTIEQTAVKDNNCVTYXXXXXXXXXXXXXLRITELPVRKWTQDY
P30182_______________PMDPWYRGFKGTIEKTASKEGGC-TYTITGLYEEVDETTIRITELPIRRWNDDY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
