UniGene Name: sp_v3.0_unigene58445
Length: 208 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene58445
T |
Ace file of the UniGene sp_v3.0_unigene58445
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Myb-like protein P n=2 Tax=Fagopyrum RepID=A5A367_9CARY | - | - | 2.0e-26 | 94% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | MYB transcription factor | - | - | 1.449e-24 | - |
| Source | Gene names |
|---|---|
| Sma3 | 23.t00069; AT4g12350; At1g09540; At1g22640; At1g35515; At2g16720; At3g02940; At3g13540; At3g61250; At4g09460; At4g12350; At4g17785; At4g22680; At4g34990; At4g38620; At5g10280; At5g16770; At5g54230; At5g54230/MDK4.5; At5g56110; At5g65230; F12K8.1; F13E7.11 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
| Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | mucilage biosynthetic process involved in seed coat development | GO:0048354 | Biological Process | 0.0 | - |
| Sma3 | tapetal layer development | GO:0048658 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13540.1 | ATMYB5, MYB5 myb domain protein 5 chr3:4420239-4421443 FORWARD LENGTH=249 | 7.0e-32 | 89% |
| RefSeq | Arabidopsis thaliana | NP_187963.1 | transcription repressor MYB5 [Arabidopsis thaliana] | 9.0e-32 | 89% |
| RefSeq | Populus trichocarpa | XP_002319686.1 | predicted protein [Populus trichocarpa] | 4.0e-34 | 94% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LNN4
Fln msg: Distance to subject end: 316 aas, atg_distance in limit (1-15): atg_distance = 6, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 57 - 390
Fln protein:
E
Protein Length:
58
Fln nts:
T
Fln Alignment:
F585NNT02GAX0P___YFYP*EEDLILRLHRLLGNRWSLIAGRMPGRTDNEVKNYWNTHLSKKLISQGIDPRTHKPLS
B8LNN4_______________HILPEEEDLILRLHRLLGNRWSLIAGRMPGRTDNEVKNYWNTHLSKKLISQGIDPRTHKPLS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta