SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene58346

Length: 310 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene58346
TCAATCTGAATTTTGGCTATTATCGGGTTCTAATAGAGCCCACAGATGTATGGAAGACCGCCTTCAAATCCATAGAGGGCCTTTTTGAATGGTTGGTCATGCCTTTCGGGTTGACAAATGCCCCTACAACTTTTATGAGGTTGATGGATCACATCTTGCGGCCCTTCACCAACTCATTCATGGTTGTATATCTGGACAACATTCTTATCTTCAGCAAGAGTTTGGAAGAGCACTTACAACACATTTGATAAGTCCTTCAAACCCTGCGACAGCACAAACTATGTGCCAACCTGGAGAAATGCACCCCCAT

Ace file of the UniGene sp_v3.0_unigene58346 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putative gag-pol polyprotein, identical [Solanum demissum]	-	-	8.0e-30	58%
FL-Next	sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion.	-	-	0.0	45%
Sma3	Retrotransposon protein, putative, Ty3-gypsy subclass	-	-	4.75e-25	-

Source	Gene names
Sma3	17.t00023; 20.t00045; AT4g03840; AT4g04230; AT4g08100; At2g06170; At2g06470; At2g06890; At2g07660; F9M13.15; H0201G08.12; H0211A12.9; H0306B06.3; LOC_Os03g05350; LOC_Os03g15450; LOC_Os03g29790; LOC_Os03g35326; LOC_Os03g42950; LOC_Os10g06110; LOC_Os10g1656

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	carbonate dehydratase activity	GO:0004089	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	cysteine-type peptidase activity	GO:0008234	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	carbon utilization	GO:0015976	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Carbonic anhydrase	IPR001765	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Peptidase C48, SUMO/Sentrin/Ubl1	IPR003653	-	-
Sma3	Putative S-adenosyl-L-methionine-dependent methyltransferase	IPR004159	-	-
Sma3	Auxin efflux carrier	IPR004776	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	HAT dimerisation	IPR008906	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3		IPR013084	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	Carbonic anhydrase, prokaryotic-like, conserved site	IPR015892	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: sp_plants

Fln subject: P31843

Fln msg: your sequence is shorter than subject: 82 - 142

Fln protein: NLNFGYYRVLIEPTDVWKTAFKSIEGLFEWLVMPFGLTNAPTTFMRLMDHILRPFTNSFMVVYLDNILIFSKSLEEHLQHI*

Protein Length: 83

Fln nts: TCAATCTGAATTTTGGCTATTATCGGGTTCTAATAGAGCCCACAGATGTATGGAAGACCGCCTTCAAATCCATAGAGGGCCTTTTTGAATGGTTGGTCATGCCTTTCGGGTTGACAAATGCCCCTACAACTTTTATGAGGTTGATGGATCACATCTTGCGGCCCTTCACCAACTCATTCATGGTTGTATATCTGGACAACATTCTTATCTTCAGCAAGAGTTTGGAAGAGCACTTACAACACATTTGA___TAAGTCCTTCAAACCCTGCGACAGCACAAACTATGTGCCAACCTGGAGAAATGCACCCCCAT

Fln Alignment:

F585NNT02IPW14___NLNFGYYRVLIEPTDVWKTAFKSIEGLFEWLVMPFGLTNAPTTFMRLMDHILRPFTNSFMVVYLDNIL---IFSKSLEEHLQHI
P31843_______________DLRSGYWQVRIAKGDEPKTTCVTRYGSFEFRVMPFGLTNALATFCNLMNNVLYEYLDHFVVVYLDDLVVYTIYSNSLHEHIKHL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain