|
||||||
|
UniGene Name: sp_v3.0_unigene58095
Length: 177 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene58095
G |
|
Ace file of the UniGene sp_v3.0_unigene58095
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DHHC-type zinc finger family protein [Arabidopsis thaliana] sp|Q8L5Y5.1|ZDH17_ARATH RecName: Full=Probable S-acyltransferase At4g15080; AltName: Full=Probable palmitoyltransferase At4g15080; AltName: Full=Zinc finger DHHC domain-containing protein At4g150 | - | - | 4.0e-17 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 43% |
| Sma3 | Zinc finger protein, putative | - | - | 4.87e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Acyltransferases, Transferring groups other than amino-acyl groups. | EC:2.3.1.- | - | 1.032e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g69420; At2g33640; At3g22180; At4g01730; At4g15080; CHLREDRAFT_186248; F10D13.9; F23O10.1; F4P9.41; FCAALL.183; GSVIVT00002912001; GSVIVT00005961001; GSVIVT00028233001; GSVIVT00037591001; LOC_Os03g11110; LOC_Os10g19180; MICPUCDRAFT_53228; MICPUN_64376; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Zinc finger, DHHC-type, palmitoyltransferase | IPR001594 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60 | IPR001844 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60/TCP-1 | IPR002423 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
| Sma3 | Peroxisome biogenesis factor 1, N-terminal | IPR015342 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G15080.1 | DHHC-type zinc finger family protein chr4:8609085-8612229 REVERSE LENGTH=718 | 2.0e-22 | 72% |
| RefSeq | Arabidopsis thaliana | NP_193244.2 | DHHC-type zinc finger family protein [Arabidopsis thaliana] | 3.0e-22 | 72% |
| RefSeq | Populus trichocarpa | XP_002306990.1 | predicted protein [Populus trichocarpa] | 6.0e-24 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMN6
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 130 aas, your sequence is shorter than subject: 47 - 284
Fln protein:
H
Protein Length:
48
Fln nts:
G
Fln Alignment:
F51TW9002GTIDS___MQFCSEVRKF----SKHCRSCDKCVDGFDHHCRWLNNCVGKKNYITFF
B8LMN6_______________LRYCQKCGQYKPPRAHHCRVCKRCVLRMDHHCVWINNCVGHENYKAFF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
