UniGene Name: sp_v3.0_unigene57936
Length: 202 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene57936
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | CBL-interacting protein kinase 25 n=6 Tax=Populus RepID=A0MNL1_POPTR | - | - | 9.0e-19 | 81% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
Sma3 | CBL-interacting serine/threonine-protein kinase, putative | - | - | 8.86e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 3.586e-28 | - |
Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 2.728e-13 | - |
Source | Gene names |
---|---|
Sma3 | ACRE216; ATPK10; At1g01140; At1g29230; At1g30270; At2g34180; At2g38490; At4g18700; At4g30960; At5g01810; At5g01820; At5g07070; At5g21326; At5g45810; At5g58380; CIPK; CIPK10; CIPK11; CIPK12; CIPK13; CIPK14; CIPK15; CIPK16; CIPK17; CIPK18; CIPK19; CIPK2; CI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | potassium channel activity | GO:0005267 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | response to nutrient | GO:0007584 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
Sma3 | potassium ion import | GO:0010107 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | NAF domain | IPR004041 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | NAF/FISL domain | IPR018451 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G58380.1 | CIPK10, PKS2, SIP1, SNRK3.8 SOS3-interacting protein 1 chr5:23597092-23598531 REVERSE LENGTH=479 | 4.0e-20 | 75% |
RefSeq | Arabidopsis thaliana | NP_568878.1 | CBL-interacting serine/threonine-protein kinase 10 [Arabidopsis thaliana] | 5.0e-20 | 75% |
RefSeq | Populus trichocarpa | XP_002325185.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-21 | 81% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWA3
Fln msg: Overlapping hits, possible frame ERROR between 91 and 90, Distance to subject end: 197 aas, your sequence is shorter than subject: 67 - 426
Fln protein:
Q
Protein Length:
68
Fln nts:
G
Fln Alignment:
F5X2MQL01EN4MU___QDGLLHTACGTPVLIVAPEVITNKGYDGAxADIWSCGVILFVLMAGYLPFRGANLMVMYKKIRKGD
A9NWA3_______________QDGLLHTACGTPA-YVSPEVITKKGYDGAxADIWSCGVILFVLMAGYLPFLDANLMVMYKKIYKGD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain