|
||||||
|
UniGene Name: sp_v3.0_unigene57916
Length: 145 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene57916
A |
|
Ace file of the UniGene sp_v3.0_unigene57916
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytokinin oxidase [Arabidopsis thaliana] | - | - | 2.0e-09 | 73% |
| FL-Next | sp=Cytokinin dehydrogenase 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 73% |
| Sma3 | Cytokinin oxidase | - | - | 8.366e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytokinin dehydrogenase. | EC:1.5.99.12 | - | 6.221e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Zeatin biosynthesis | 00908 | 6.221e-13 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g75450; At3g63440; At5g56970; BoCKX1; BrCKX1; CKX3; CKX5; CKX6; CKX7; F1B16.2; GSVIVT00013006001; GSVIVT00014541001; GSVIVT00028666001; GSVIVT00033803001; GSVIVT00033806001; GSVIVT00033815001; MHM17.8; MtrDRAFT_AC148775g18v2; PHYPADRAFT_13254; PHYPADRA |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | primary amine oxidase activity | GO:0008131 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | cytokinin dehydrogenase activity | GO:0019139 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | cytokinin metabolic process | GO:0009690 | Biological Process | 0.0 | - |
| Sma3 | cytokinin catabolic process | GO:0009823 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxygen oxidoreductase covalent FAD-binding site | IPR006093 | - | 0.0 | - |
| Sma3 | FAD linked oxidase, N-terminal | IPR006094 | - | 0.0 | - |
| Sma3 | Cytokinin dehydrogenase 1, FAD/cytokinin binding domain | IPR015345 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2, subdomain 1 | IPR016167 | - | 0.0 | - |
| Sma3 | FAD-linked oxidase, FAD-binding, subdomain 2 | IPR016168 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G75450.1 | CKX5, ATCKX5, ATCKX6 cytokinin oxidase 5 chr1:28315248-28318064 REVERSE LENGTH=540 | 9.0e-14 | 73% |
| RefSeq | Arabidopsis thaliana | NP_001185402.1 | cytokinin dehydrogenase 5 [Arabidopsis thaliana] | 8.0e-14 | 69% |
| RefSeq | Populus trichocarpa | XP_002304773.1 | cytokinin oxidase [Populus trichocarpa] | 7.0e-14 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q67YU0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 301 aas, your sequence is shorter than subject: 48 - 540
Fln protein:
W
Protein Length:
49
Fln nts:
A
Fln Alignment:
F5X2MQL01B2HJM___GKGDVLNCSKDENTELFHAVLGGLGQFGIITKVRIALE
Q67YU0_______________GKGEVMRCSEEENTRLFHGVLGGLGQFGIITRARISLE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
