UniGene Name: sp_v3.0_unigene57905
Length: 177 nt
UniGene Fasta |
---|
>sp_v3.0_unigene57905
T |
Ace file of the UniGene sp_v3.0_unigene57905 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | heat shock protein 70B [Arabidopsis thaliana] gb|AAF18501.1|AC010924_14 Identical to gb|AJ002551 heat shock protein 70 from Arabidopsis thaliana and contains a PF|00012 HSP 70 domain. EST gb|F13893 comes from this gene gb|AAN71999.1| heat shock protein hs | - | - | 2.0e-12 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Heat shock protein 70 | - | - | 4.954e-23 | - |
Source | Gene names |
---|---|
Sma3 | At1g16030; At1g56410; At3g09440; At3g12580; At5g02490; At5g02500; CHLREDRAFT_185673; F11F8; F13N6.9; F3L24.33; GSVIVT00017185001; GSVIVT00018481001; GSVIVT00018506001; GSVIVT00021301001; GSVIVT00024351001; GSVIVT00024357001; HSC-2; HSC-I; HSC70; HSC70-1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleomorph | GO:0033009 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G16030.1 | Hsp70b heat shock protein 70B chr1:5502386-5504326 REVERSE LENGTH=646 | 6.0e-17 | 75% |
RefSeq | Arabidopsis thaliana | NP_173055.1 | heat shock protein 70B [Arabidopsis thaliana] | 8.0e-17 | 75% |
RefSeq | Populus trichocarpa | XP_002332067.1 | predicted protein [Populus trichocarpa] | 8.0e-17 | 75% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NXU2
Fln msg: Distance to subject end: 106 aas, your sequence is shorter than subject: 58 - 651
Fln protein:
G
Protein Length:
59
Fln nts:
T
Fln Alignment:
F5X2MQL01EJ23Q___GILNVRVPEDKTAGIKNKITITNDKGRLSKAERLRRMVQDAEKYKQEDEDVKK
A9NXU2_______________GILNVSA-EDKTAGVKNKITITNDKGRLSK-EEIEKMVHDAEKYKAEDEEVKK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain