UniGene Name: sp_v3.0_unigene57797
Length: 177 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene57797
A |
Ace file of the UniGene sp_v3.0_unigene57797 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam01370, Epimerase, NAD dependent epimerase/dehydratase family | - | - | 4.0e-07 | 40% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
| Sma3 | UDP-glucuronic acid decarboxylase | - | - | 2.182e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucuronate decarboxylase. | EC:4.1.1.35 | - | 1.332e-27 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 1.332e-27 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 1.332e-27 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.332e-27 | % | |
| Sma3 | dTDP-glucose 4,6-dehydratase. | EC:4.2.1.46 | - | 4.862e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Polyketide sugar unit biosynthesis | 00523 | 4.862e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.862e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.862e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT2G47650; AT3G46440; At2g28760; At3g46440; At3g53520; At3g62830; At5g59290; B1012D10.32; CHLREDRAFT_135101; D18; DGD1; DGD2; F18L15.160; F26K9_260; F4P12.220; F4P12_220; GAD1; GSVIVT00018513001; GSVIVT00023112001; GSVIVT00024364001; GSVIVT00028008001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
| Sma3 | UDP-glucuronate decarboxylase activity | GO:0048040 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G46440.1 | UXS5 UDP-XYL synthase 5 chr3:17089268-17091611 REVERSE LENGTH=341 | 2.0e-27 | 97% |
| RefSeq | Arabidopsis thaliana | NP_001030820.1 | UDP-XYL synthase 5 [Arabidopsis thaliana] | 3.0e-27 | 97% |
| RefSeq | Populus trichocarpa | XP_002315231.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 97% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUD0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 117 aas, your sequence is shorter than subject: 49 - 351
Fln protein:
I
Protein Length:
50
Fln nts:
A
Fln Alignment:
F5X2MQL01BAEGP___IGVRSCYDEGKRVAETLMFDYHRQHGLEIRIARIFNTYGPRMNIDDG
A9NUD0_______________IGVRSCYDEGKRVAETLMFDYHRQHGLEIRIARIFNTYGPRMNIDDG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)