SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene57720

Length: 281 nt

UniGene Fasta

>sp_v3.0_unigene57720
ATGGGGAGGATGAAGATATTGGAGTAGTTGTTAGCAATGGTATCCAGCTTCTTGTTCTCTGGAGTTGGGCTCTTGGGCGACATTGCAGTACAACCTGCTTCGTTCTTTACTATACTTCCTACGTCAAGATCGTTCCCTTTCATTGTTCCATATCTTCTCTTTGAAAACACAATGTCTGTAACAAAATTCAATGCCATTATCTCTAGGCTCTTTCAAATTGGCAGTGTTTGTGAATGGGTGGTGACAAAAGNGTTAGGCAGATCATCTGAAGCTGATTTAGT

Ace file of the UniGene sp_v3.0_unigene57720

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Cellulose synthase-like C1-1, glycosyltransferase family 2 protein n=2 Tax=Selaginella moellendorffii RepID=D8RV47_SELML	-	-	6.0e-19	76%
FL-Next	tr=Cellulose synthase-like A2; Pinus taeda (Loblolly pine).	-	-	0.0	45%
Sma3	Cellulose synthase-like protein C4	-	-	2.951e-08	-

Source	ECs	Term	Type	e value	Identity
Sma3	Transferases, Glycosyltransferases, Hexosyltransferases.	EC:2.4.1.-	-	4.863e-26	-

Source	KEGGs	Term	e value	Identity
Sma3	Fructose and mannose metabolism	00051	4.863e-26	%
Sma3	N-Glycan biosynthesis	00510	4.863e-26	%
Sma3	Mucin type O-Glycan biosynthesis	00512	4.863e-26	%
Sma3	Various types of N-glycan biosynthesis	00513	4.863e-26	%
Sma3	Other types of O-glycan biosynthesis	00514	4.863e-26	%
Sma3	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	4.863e-26	%
Sma3	Glycosaminoglycan biosynthesis - keratan sulfate	00533	4.863e-26	%
Sma3	Lipopolysaccharide biosynthesis	00540	4.863e-26	%
Sma3	Peptidoglycan biosynthesis	00550	4.863e-26	%
Sma3	Glycerolipid metabolism	00561	4.863e-26	%
Sma3	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis	00563	4.863e-26	%
Sma3	Sphingolipid metabolism	00600	4.863e-26	%
Sma3	Glycosphingolipid biosynthesis - lacto and neolacto series	00601	4.863e-26	%
Sma3	Glycosphingolipid biosynthesis - globo series	00603	4.863e-26	%
Sma3	Glycosphingolipid biosynthesis - ganglio series	00604	4.863e-26	%
Sma3	Carotenoid biosynthesis	00906	4.863e-26	%
Sma3	Zeatin biosynthesis	00908	4.863e-26	%
Sma3	Flavonoid biosynthesis	00941	4.863e-26	%
Sma3	Anthocyanin biosynthesis	00942	4.863e-26	%
Sma3	Flavone and flavonol biosynthesis	00944	4.863e-26	%
Sma3	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	4.863e-26	%
Sma3	Betalain biosynthesis	00965	4.863e-26	%
Sma3	Biosynthesis of type II polyketide products	01057	4.863e-26	%
Sma3	Metabolic pathways	01100	4.863e-26	%
Sma3	Biosynthesis of secondary metabolites	01110	4.863e-26	%

Source	Gene names
Sma3	At2g24630; At3g07330; At3g28180; At4g07960; At4g31590; CSLC1; CSLC10; CSLC12; CSLC2; CSLC3; CSLC4; CSLC5; CSLC6; CSLC7; CSLC8; CSLC9; CslC1; CslC2; CslC3; F1K3.3; F21O3.4; F25P17.7; F28M20.220; GSVIVT00000743001; GSVIVT00008341001; GSVIVT00014999001; GSVI

Source	GOs	Term	Type	Identity
Sma3	Golgi membrane	GO:0000139	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	transferase activity	GO:0016740	Molecular Function	-
Sma3	transferase activity, transferring glycosyl groups	GO:0016757	Molecular Function	-
Sma3	cellular cell wall organization	GO:0007047	Biological Process	-

Source	InterPros	Term	Type	e value	Identity
Sma3	Glycosyl transferase, family 2	IPR001173	-	0.0	-
Sma3	Inorganic pyrophosphatase	IPR008162	-	0.0	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G07960.1	ATCSLC12, CSLC12 Cellulose-synthase-like C12 chr4:4802628-4805114 REVERSE LENGTH=699	9.0e-24	76%
RefSeq	Arabidopsis thaliana	NP_192536.1	putative xyloglucan glycosyltransferase 12 [Arabidopsis thaliana]	1.0e-23	76%
RefSeq	Populus trichocarpa	XP_002320599.1	predicted protein [Populus trichocarpa]	2.0e-25	80%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A3QT95

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 66 aas, your sequence is shorter than subject: 93 - 534

Fln protein: MGRMKILE*LLAMVSSFLFSGVGLLGDIAVQPASFFTILPTSRSFPFIVPYLLFENTMSVTKFNAIISRLFQIGSVCEWVVTKELGRSSEADL

Protein Length: 94

Fln nts: ATGGGGAGGATGAAGATATTGGAGTAGTTGTTAGCAATGGTATCCAGCTTCTTGTTCTCTGGAGTTGGGCTCTTGGGCGACATTGCAGTACAACCTGCTTCGTTCTTTACTATACTTCCTACGTCAAGATCGTTCCCTTTCATTGTTCCATATCTTCTCTTTGAAAACACAATGTCTGTAACAAAATTCAATGCCATTATCTCTAGGCTCTTTCAAATTGGCAGTGTTTGTGAATGGGTGGTGACAAAAGaGTTAGGCAGATCATCTGAAGCTGATTTAGT

Fln Alignment:

F5X2MQL01B5AIU___AVQPASFFTIL---PTSRSFPFIVPYLLFENTMSVTKFNAIISRLFQIGSVCEWVVTKELG
A3QT95_______________AVYIPSTITLLNAVSTPRSLHLLVFWILFENVMSLHRTKATIIGLFEAGRVNEWVVTEKLG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain