UniGene Name: sp_v3.0_unigene57554
Length: 159 nt
![]() |
---|
>sp_v3.0_unigene57554
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | MDR-like ABC transporter n=1 Tax=Ginkgo biloba RepID=E6Y0T2_GINBI | - | - | 6.0e-09 | 93% |
FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 68% |
Sma3 | Multidrug/pheromone exporter, MDR family, ABC transporter family | - | - | 1.025e-20 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 4.264e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g10680; At2g36910; At3g28345; At3g28360; At3g28380; At3g28390; At3g28415; At3g28860; At4g18050; At4g25960; CHLREDRAFT_138602; CMDR1; F15J5.20; F20B24.12; GSVIVT00000633001; GSVIVT00003365001; GSVIVT00003377001; GSVIVT00015726001; GSVIVT00020846001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | auxin efflux transmembrane transporter activity | GO:0010329 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | regulation of cell size | GO:0008361 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | response to blue light | GO:0009637 | Biological Process | 0.0 | - |
Sma3 | photomorphogenesis | GO:0009640 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
Sma3 | positive gravitropism | GO:0009958 | Biological Process | 0.0 | - |
Sma3 | response to far red light | GO:0010218 | Biological Process | 0.0 | - |
Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
Sma3 | acropetal auxin transport | GO:0010541 | Biological Process | 0.0 | - |
Sma3 | anthocyanin accumulation in tissues in response to UV light | GO:0043481 | Biological Process | 0.0 | - |
Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
Sma3 | lateral root development | GO:0048527 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
Sma3 | Dephospho-CoA kinase | IPR001977 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G25960.1 | PGP2 P-glycoprotein 2 chr4:13177438-13183425 FORWARD LENGTH=1273 | 2.0e-12 | 87% |
RefSeq | Arabidopsis thaliana | NP_194326.2 | P-glycoprotein 2 [Arabidopsis thaliana] | 3.0e-12 | 87% |
RefSeq | Populus trichocarpa | XP_002326736.1 | multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] | 1.0e-11 | 81% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 166 aas, your sequence is shorter than subject: 37 - 1316
Fln protein:
G
Protein Length:
38
Fln nts:
A
Fln Alignment:
F5X2MQL01D05XN___PAGKVVAIVGGSGSGKSTVISFIERFYDPISG
E6Y0T0_______________PSGTTAALVGESGSGKSTVISLVERFYDPQAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain