|
||||||
|
UniGene Name: sp_v3.0_unigene57299
Length: 168 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene57299
A |
|
Ace file of the UniGene sp_v3.0_unigene57299
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Carotenoid isomerase, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9SDN0_RICCO | - | - | 1.0e-21 | 87% |
| FL-Next | sp=Prolycopene isomerase, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 90% |
| Sma3 | Carotenoid isomerase | - | - | 4.699e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:5.-.-.- | - | 7.688e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g06820; CCR2; CHLREDRAFT_196597; CRTISO; CRTISO1; CRTISO2; F4H5.10; GSVIVT00027139001; LOC_Os11g36440; Os11g0572700; OsI_36549; OsI_36559; OsJ_34321; PHYPADRAFT_194048; PHYPADRAFT_88169; POPTRDRAFT_866125; POPTRDRAFT_904781; RCOM_0422660; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | isomerase activity | GO:0016853 | Molecular Function | 0.0 | - |
| Sma3 | carotenoid isomerase activity | GO:0046608 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | tRNA processing | GO:0008033 | Biological Process | 0.0 | - |
| Sma3 | etioplast organization | GO:0009662 | Biological Process | 0.0 | - |
| Sma3 | carotenoid biosynthetic process | GO:0016117 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA-binding protein Dps | IPR002177 | - | 0.0 | - |
| Sma3 | Glucose-inhibited division protein A-related | IPR002218 | - | 0.0 | - |
| Sma3 | Aromatic-ring hydroxylase-like | IPR003042 | - | 0.0 | - |
| Sma3 | Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal | IPR003953 | - | 0.0 | - |
| Sma3 | FAD dependent oxidoreductase | IPR006076 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | Carotene isomerase | IPR014101 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G06820.1 | CRTISO, CCR2 carotenoid isomerase chr1:2093145-2096220 REVERSE LENGTH=595 | 6.0e-28 | 90% |
| RefSeq | Arabidopsis thaliana | NP_172167.2 | carotenoid isomerase [Arabidopsis thaliana] | 8.0e-28 | 90% |
| RefSeq | Populus trichocarpa | XP_002323362.1 | predicted protein [Populus trichocarpa] | 6.0e-28 | 87% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9M9Y8
Fln msg: Distance to subject end: 19 aas, your sequence is shorter than subject: 56 - 595
Fln protein:
K
Protein Length:
57
Fln nts:
A
Fln Alignment:
F5V9AAZ01DB3WS___PKGLLGMPIFNTTGVDGLYCVGDSCFPGQGVIAVAFSGIMCAHRVAADIGLKKK
Q9M9Y8_______________PKGLLGMP-FNTTAIDGLYCVGDSCFPGQGVIAVAFSGVMCAHRVAADIGLEKK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
