SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene57154

Length: 231 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene57154
TTGCAAACTCTCTTGGGGTTCGTATCCATAATATACGTGTTATAACAAGAAGAGTAGGTGGTGGGTTTGGTGGGAAGGCCATCAGATGCATGCCGGTTGCAGTTGCATGTGCAGTAGCTGCATACAAGCTGAGGCGGCCTGTACCGAAATAGTAATACTTAGAATACGTAAAAACAAGAACAATAGAATACAATAGGACTGGTGGGCGTCACCCTATCAAGGTAAACTACA

Ace file of the UniGene sp_v3.0_unigene57154 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Aldehyde oxidase n=1 Tax=Solanum lycopersicum RepID=Q9FV24_SOLLC	-	-	7.0e-13	55%
FL-Next	sp=Abscisic-aldehyde oxidase; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	56%
Sma3	Aldehyde oxidase	-	-	4.449e-17	-

Source	ECs	Term	Type	e value	Identity
Sma3	Aldehyde oxidase.	EC:1.2.3.1	-	1.882e-31	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Valine, leucine and isoleucine degradation	00280		1.882e-31	%
Sma3	Tyrosine metabolism	00350		1.882e-31	%
Sma3	Tryptophan metabolism	00380		1.882e-31	%
Sma3	Vitamin B6 metabolism	00750		1.882e-31	%
Sma3	Nicotinate and nicotinamide metabolism	00760		1.882e-31	%
Sma3	Drug metabolism - cytochrome P450	00982		1.882e-31	%
Sma3	Metabolic pathways	01100		1.882e-31	%
Sma3	Abscisic-aldehyde oxidase.	EC:1.2.3.14	-	8.564e-08	-

Source	KEGGs	Term	e value	Identity
Sma3	Carotenoid biosynthesis	00906	8.564e-08	%
Sma3	Biosynthesis of terpenoids and steroids	01062	8.564e-08	%
Sma3	Biosynthesis of plant hormones	01070	8.564e-08	%
Sma3	Metabolic pathways	01100	8.564e-08	%
Sma3	Biosynthesis of secondary metabolites	01110	8.564e-08	%

Source	Gene names
Sma3	AAO1; AAO2; AAO3; AAO4; AO1; AO2; AO3; AO4; At1g04580; At2g27150; At3g43600; At5g20960; BrAO1; BrAO2; F20F1.2; F22D1.130; F22J12.40; GSVIVT00017483001; GSVIVT00021879001; LOC_Os03g57680; LOC_Os03g57690; LOC_Os10g04860; LsAO1; OSJNAa0087H07.7; OSJNBa0087O0

Source	GOs	Term	Type	Identity
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	aldehyde oxidase activity	GO:0004031	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	abscisic aldehyde oxidase activity	GO:0010293	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	molybdenum ion binding	GO:0030151	Molecular Function	-
Sma3	metal ion binding	GO:0046872	Molecular Function	-
Sma3	indole-3-acetaldehyde oxidase activity	GO:0050302	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	iron-sulfur cluster binding	GO:0051536	Molecular Function	-
Sma3	2 iron, 2 sulfur cluster binding	GO:0051537	Molecular Function	-
Sma3	abscisic acid biosynthetic process	GO:0009688	Biological Process	-
Sma3	auxin biosynthetic process	GO:0009851	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Oxidoreductase, molybdopterin-binding domain	IPR000572	-	-
Sma3	Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead	IPR000674	-	-
Sma3	2Fe-2S ferredoxin-type domain	IPR001041	-	-
Sma3	Molybdopterin dehydrogenase, FAD-binding	IPR002346	-	-
Sma3	[2Fe-2S]-binding	IPR002888	-	-
Sma3	CO dehydrogenase flavoprotein, C-terminal	IPR005107	-	-
Sma3	2Fe-2S ferredoxin, iron-sulphur binding site	IPR006058	-	-
Sma3	Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding	IPR008274	-	-
Sma3	Beta-grasp domain	IPR012675	-	-
Sma3	FAD-binding, type 2	IPR016166	-	-
Sma3	CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2	IPR016169	-	-
Sma3	Aldehyde oxidase/xanthine dehydrogenase	IPR016208	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	Peptidase S26A, signal peptidase I, serine active site	IPR019756	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G27150.1	AAO3, At-AO3, AOdelta, AtAAO3 abscisic aldehyde oxidase 3 chr2:11601952-11607014 FORWARD LENGTH=1332	1.0e-16	56%
RefSeq	Arabidopsis thaliana	NP_180283.1	abscisic-aldehyde oxidase [Arabidopsis thaliana]	2.0e-16	56%
RefSeq	Populus trichocarpa	XP_002313633.1	aldehyde oxidase 1 [Populus trichocarpa]	2.0e-13	55%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q7G9P4

Fln msg: Distance to subject end: 484 aas, your sequence is shorter than subject: 76 - 1332

Fln protein: ANSLGVRIHNIRVITRRVGGGFGGKAIRCMPVAVACAVAAYKLRRPVPK**YLEYVKTRTIEYNRTGGRHPIKVNY

Protein Length: 77

Fln nts: TTGCAAACTCTCTTGGGGTTCGTATCCATAATATACGTGTTATAACAAGAAGAGTAGGTGGTGGGTTTGGTGGGAAGGCCATCAGATGCATGCCGGTTGCAGTTGCATGTGCAGTAGCTGCATACAAGCTGAGGCGGCCTGTACCGAAATAGTAATACTTAGAATACGTAAAAACAAGAACAATAGAATACAATAGGACTGGTGGGCGTCACCCTATCAAGGTAAACTACA

Fln Alignment:

F51TW9002IK2WR___ANSLGVRIHNIRVITRRVGGGFGGKAIRCMPXXXXXXXXAYKLRRPVPK**YLEYVKTRTIEYNRTGGRHPIKVNY
Q7G9P4_______________ATCLGIQEHNVRVITRRVGGGFGGKAVKSMPVATACALGAYKLQRPV------KMFLNRKTDMIMAGGRHPMKINY

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain