UniGene Name: sp_v3.0_unigene57153
Length: 197 nt
UniGene Fasta |
---|
>sp_v3.0_unigene57153
A |
Ace file of the UniGene sp_v3.0_unigene57153 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glyceraldehyde-3-phosphate dehydrogenase n=5 Tax=Pinaceae RepID=Q37264_PINSY | - | - | 3.0e-13 | 74% |
FL-Next | tr=Glyceraldehyde-3-phosphate dehydrogenase; Pinus sylvestris (Scots pine). Plastid; Chloroplast. | - | - | 0.0 | 74% |
Sma3 | NAD-dependent glyceraldehyde-3-phosphate dehydrogenase | - | - | 1.125e-38 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). | EC:1.2.1.12 | - | 2.055e-29 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 2.055e-29 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.055e-29 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 2.055e-29 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 2.055e-29 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 2.055e-29 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 2.055e-29 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 2.055e-29 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 2.055e-29 | % | |
Sma3 | Metabolic pathways | 01100 | 2.055e-29 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.055e-29 | % |
Source | Gene names |
---|---|
Sma3 | At1g16300; At1g79530; At1g79530/T8K14_5; F3O9.10; G3pdh; GAPC; GAPDH; GAPDH1; GSVIVT00002074001; GapC; GapC2; GapCp; GapCp1; OJ000223_09.15; OJ1116_A06.36; OJ1791_B03.34; Os02g0171100; Os02g0601300; Os04g0486600; Os06g0666600; OsI_06028; OsI_07948; OsI_16 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G79530.1 | GAPCP-1 glyceraldehyde-3-phosphate dehydrogenase of plastid 1 chr1:29916232-29919088 REVERSE LENGTH=422 | 6.0e-13 | 65% |
RefSeq | Arabidopsis thaliana | NP_178071.1 | glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana] | 7.0e-13 | 65% |
RefSeq | Populus trichocarpa | XP_002315071.1 | predicted protein [Populus trichocarpa] | 1.0e-13 | 68% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q37265
Fln msg: Separated hits, possible frame ERROR between 129 and 138, Unexpected STOP codon at 3' end. Distance to subject end: 52 aas, your sequence is shorter than subject: 65 - 433
Fln protein:
M
Protein Length:
66
Fln nts:
A
Fln Alignment:
F51TW9002H4C1J___RLTGMAFRVPTPNVSVVDLVQCRLAKPASYDDIKA-------GQLKGxxxKGQLKGILGYTDEDVVSK*F
Q37265_______________KLTGMAFRVPTPNVSVVDLT-CRLEKPASYDDIKAAMKAASEGSLKGxxxEGSLKGILGYTDEDVVSNDF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain