UniGene Name: sp_v3.0_unigene57103
Length: 145 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene57103
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=UDP-glucose 4-epimerase; AltName: Full=Galactowaldenase; AltName: Full=UDP-galactose 4-epimerase gb|AAA86532.1| UDP-galactose-4-epimerase [Pisum sativum] | - | - | 5.0e-16 | 85% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | UDP-glucose 4-epimerase | - | - | 7.787e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UDP-glucose 4-epimerase. | EC:5.1.3.2 | - | 3.716e-29 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Galactose metabolism | 00052 | 3.716e-29 | % | |
Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 3.716e-29 | % | |
Sma3 | Metabolic pathways | 01100 | 3.716e-29 | % |
Source | Gene names |
---|---|
Sma3 | AT1G12780; At1g12780; At1g63180; At1g63180/F16M19_8; At1g64440; At4g10960; At4g23920; At4g23920/T32A16_90; F13K23.3; F15H21.11; F16M19.8; F25I24.170; F8M12.10; GALE; GSVIVT00001116001; GSVIVT00006740001; GSVIVT00006742001; GalE; OJ1439_F07.18; OSJNBa0030I |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | UDP-glucose 4-epimerase activity | GO:0003978 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | galactose metabolic process | GO:0006012 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | plant-type cell wall biogenesis | GO:0009832 | Biological Process | 0.0 | - |
Sma3 | xyloglucan biosynthetic process | GO:0009969 | Biological Process | 0.0 | - |
Sma3 | root epidermal cell differentiation | GO:0010053 | Biological Process | 0.0 | - |
Sma3 | cell wall biogenesis | GO:0042546 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sulfatase | IPR000917 | - | 0.0 | - |
Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
Sma3 | UDP-glucose 4-epimerase | IPR005886 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Nucleotide sugar epimerase | IPR008089 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G12780.1 | UGE1, ATUGE1 UDP-D-glucose/UDP-D-galactose 4-epimerase 1 chr1:4356124-4358120 REVERSE LENGTH=351 | 6.0e-22 | 85% |
RefSeq | Arabidopsis thaliana | NP_172738.1 | UDP-D-glucose/UDP-D-galactose 4-epimerase 1 [Arabidopsis thaliana] | 8.0e-22 | 85% |
RefSeq | Populus trichocarpa | XP_002304478.1 | predicted protein [Populus trichocarpa] | 4.0e-21 | 85% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKM2
Fln msg: Distance to subject end: 160 aas, your sequence is shorter than subject: 47 - 356
Fln protein:
I
Protein Length:
48
Fln nts:
T
Fln Alignment:
F51TW9002I4TUQ___IPCVEDFQLSAMNPYGRTKLFLEEIARDIYKADPDWKRIILLRYFNP
B8LKM2_______________IPCVEDFQLSAMNPYGRTKLFLEEIARDVYQADPDW-RIILLRYFNP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain