UniGene Name: sp_v3.0_unigene57053
Length: 186 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene57053
T |
Ace file of the UniGene sp_v3.0_unigene57053 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cysteine-rich receptor-like protein kinase 2 [Arabidopsis thaliana] sp|Q9CAL3.1|CRK2_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 2; Short=Cysteine-rich RLK2; Flags: Precursor gb|AAG52471.1|AC010796_10 putative protein kinase; 37247-3480 | - | - | 9.0e-11 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Putative Receptor-like serine/threonine kinase(RFK1) | - | - | 7.049e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g70520; CRK2; F24J13.9; GSVIVT00002759001; GSVIVT00002761001; GSVIVT00004456001; GSVIVT00007790001; GSVIVT00009975001; GSVIVT00010713001; GSVIVT00013134001; GSVIVT00016037001; H0525G02.11; H0525G02.12; H0818E11.1; OJ1014_H11.14; OJ1014_H11.17-1; OSJNBa |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70520.1 | CRK2 cysteine-rich RLK (RECEPTOR-like protein kinase) 2 chr1:26584888-26587334 REVERSE LENGTH=649 | 5.0e-15 | 64% |
RefSeq | Arabidopsis thaliana | NP_177209.1 | cysteine-rich receptor-like protein kinase 2 [Arabidopsis thaliana] | 7.0e-15 | 64% |
RefSeq | Populus trichocarpa | XP_002332645.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPW7
Fln msg: Distance to subject end: 201 aas, your sequence is shorter than subject: 61 - 702
Fln protein:
N
Protein Length:
62
Fln nts:
T
Fln Alignment:
F51TW9002H4HEG___DENRGRLLDWQRRFEIILGIAAGLAYLHEESDIRIIHRDVKASNI
C0PPW7_______________DPTKRHLLDWKKRSEIILGTARGLAYLHEESDVRVIHRDIKASNI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain