UniGene Name: sp_v3.0_unigene57005
Length: 247 nt
UniGene Fasta |
---|
>sp_v3.0_unigene57005
C |
Ace file of the UniGene sp_v3.0_unigene57005 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Source | Gene names |
---|---|
Sma3 | At1g09410; At1g74600; At1g74630; At4g13650; At5g44230; F14J9.7; F18A5.40; F1M20.28; F1M20.31; F3O9.28; GSVIVT00003060001; GSVIVT00004379001; GSVIVT00006467001; GSVIVT00006516001; GSVIVT00007631001; GSVIVT00007922001; GSVIVT00008660001; GSVIVT00011403001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTs/EF1B, dimerisation | IPR014039 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09410.1 | pentatricopeptide (PPR) repeat-containing protein chr1:3035443-3037560 FORWARD LENGTH=705 | 5.0e-22 | 56% |
RefSeq | Arabidopsis thaliana | NP_172412.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 6.0e-22 | 56% |
RefSeq | Populus trichocarpa | XP_002330082.1 | predicted protein [Populus trichocarpa] | 2.0e-25 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 141 aas, your sequence is shorter than subject: 82 - 312
Fln protein:
L
Protein Length:
83
Fln nts:
C
Fln Alignment:
F51TW9002JQ26D___FINKMSAKPGALVWQTLLGACRIYGNMEVGRRVAECLLELEPQDSGTYVLLSNIYAAAGRWADVANVRKLMKE
D5ADG9_______________FIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAELLLNLDPDNAGYYVLLSNIYAAAGRWDDVAKVRKMMKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain