UniGene Name: sp_v3.0_unigene56784
Length: 180 nt
![]() |
---|
>sp_v3.0_unigene56784
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Xylem serine proteinase 1, putative n=1 Tax=Ricinus communis RepID=B9RYG6_RICCO | - | - | 1.0e-15 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Subtilisin-like protease | - | - | 5.718e-17 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cucumisin. | EC:3.4.21.25 | - | 9.066e-15 | - |
Source | Gene names |
---|---|
Sma3 | AT4g34980; At3g14067; At4g34980; At5g45650; At5g45650/MRA19_5; At5g51750; GSVIVT00000486001; GSVIVT00014840001; GSVIVT00014841001; GSVIVT00014843001; GSVIVT00014845001; GSVIVT00014846001; GSVIVT00014936001; GSVIVT00019628001; GSVIVT00024311001; GSVIVT0002 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
Sma3 | negative regulation of catalytic activity | GO:0043086 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G14067.1 | Subtilase family protein chr3:4658421-4660754 REVERSE LENGTH=777 | 6.0e-20 | 74% |
RefSeq | Arabidopsis thaliana | NP_566473.2 | Subtilase family protein [Arabidopsis thaliana] | 8.0e-20 | 74% |
RefSeq | Populus trichocarpa | XP_002310134.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 65% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLN6
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 333 aas, your sequence is shorter than subject: 48 - 522
Fln protein:
G
Protein Length:
49
Fln nts:
T
Fln Alignment:
F51TW9002IJLI3___GLWPLSHHGDDVIVGVLDTGIWPESKSFSDQGLTPVPSRWKGECEVG
B8LLN6_______________GLWPLSRYGDDIIVGVLDTGIWPESKSFNDQGLTPVPARWKGECEVG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain