UniGene Name: sp_v3.0_unigene56743
Length: 188 nt
UniGene Fasta |
---|
>sp_v3.0_unigene56743
A |
Ace file of the UniGene sp_v3.0_unigene56743 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RVT_2 domain containing protein | - | - | 7.0e-28 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 1.038e-29 | - |
Source | Gene names |
---|---|
Sma3 | B1110B01.13; F11I4_21; Fourf gag/pol; H0716A07.9; LOC_Os03g14060; LOC_Os03g21050; LOC_Os03g31134; LOC_Os03g33640; LOC_Os03g41000; LOC_Os03g43610; LOC_Os03g44280; LOC_Os03g53560; LOC_Os03g54804; LOC_Os03g60230; LOC_Os03g61660; LOC_Os10g01750; LOC_Os10g2173 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | Rhamnogalacturonate lyase | IPR010325 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1263 | IPR010685 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 265 aas, your sequence is shorter than subject: 62 - 363
Fln protein:
A
Protein Length:
63
Fln nts:
A
Fln Alignment:
F51TW9002FS100___ADDNVEKYKSRFVAKGYAQKEGIDY*ETCAPVARYTSIRTVISLATQMGWEIHQMDFKTTF
B8LKV8_______________ANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain