UniGene Name: sp_v3.0_unigene56718
Length: 236 nt
![]() |
---|
>sp_v3.0_unigene56718
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Laccase n=2 Tax=Pinus taeda RepID=Q9AUI3_PINTA | - | - | 1.0e-31 | 84% |
FL-Next | tr=Laccase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 84% |
Sma3 | Laccase | - | - | 1.684e-26 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Laccase. | EC:1.10.3.2 | - | 0.0 | - |
Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 3.581e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 3.581e-19 | % | |
Sma3 | Metabolic pathways | 01100 | 3.581e-19 | % |
Source | Gene names |
---|---|
Sma3 | At2g29130; At2g30210; At2g40370; At5g05390; At5g07130; At5g60020; B1088C09.5; GLac90; GSVIVT00001780001; GSVIVT00006357001; GSVIVT00006373001; GSVIVT00006374001; GSVIVT00018428001; GSVIVT00018452001; GSVIVT00018453001; GSVIVT00018454001; GSVIVT00021343001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidoreductase, molybdopterin-binding domain | IPR000572 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | Laccase | IPR017761 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G05390.1 | LAC12 laccase 12 chr5:1594753-1597042 FORWARD LENGTH=565 | 5.0e-32 | 66% |
RefSeq | Arabidopsis thaliana | NP_196158.1 | laccase 12 [Arabidopsis thaliana] | 7.0e-32 | 66% |
RefSeq | Populus trichocarpa | XP_002315131.1 | laccase 90c [Populus trichocarpa] | 3.0e-31 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9AUI3
Fln msg: Distance to subject end: 351 aas, your sequence is shorter than subject: 78 - 570
Fln protein:
V
Protein Length:
79
Fln nts:
T
Fln Alignment:
F51TW9002GTDYR___ALIISPSLGKTYPFTKPDSQIPIVLGEWWNRNPIDVVNQATRTGAAPNVSDAFTINGQPGDLYQCSSSDTFRVSV
Q9AUI3_______________ALVISPSPGATYPFTRPHGQVPILLGEWWSRNPIDVVDQATRTGAAPNVSDAFTINGQPGDLYQCSSSDTIRVSI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain