UniGene Name: sp_v3.0_unigene56490
Length: 200 nt
![]() |
---|
>sp_v3.0_unigene56490
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Heat shock protein 82 n=20 Tax=Magnoliophyta RepID=HSP82_MAIZE | - | - | 8.0e-17 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Heat shock protein 90 | - | - | 1.922e-25 | - |
Source | Gene names |
---|---|
Sma3 | At5g52640; At5g56000; At5g56010; At5g56030; CHLREDRAFT_138117; GSVIVT00002550001; GSVIVT00004280001; GSVIVT00033436001; GSVIVT00037730001; HSC80; HSP81-1; HSP81-2; HSP81-3; HSP81.2; HSP82; HSP83; HSP83A; HSP90; HSP90-1; HSP90-2; HSP90A; HSP90_1; Hsp90; LO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | heat acclimation | GO:0010286 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Sma3 | protein stabilization | GO:0050821 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp90 | IPR001404 | - | 0.0 | - |
Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G52640.1 | HSP81-1, ATHS83, HSP81.1, HSP83, ATHSP90.1, AtHsp90-1, HSP90.1 heat shock protein 90.1 chr5:21352542-21355147 FORWARD LENGTH=705 | 4.0e-21 | 88% |
RefSeq | Arabidopsis thaliana | NP_200076.1 | heat shock protein 81-1 [Arabidopsis thaliana] | 6.0e-21 | 88% |
RefSeq | Populus trichocarpa | XP_002327494.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 91% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMS8
Fln msg: Distance to subject end: 74 aas, your sequence is shorter than subject: 66 - 209
Fln protein:
S
Protein Length:
67
Fln nts:
T
Fln Alignment:
F51TW9001AFHU8___SDRIEDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSKQET
A9NMS8_______________SDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain