SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene56343

Length: 295 nt

UniGene Fasta

>sp_v3.0_unigene56343
CTAACAGTCTACCAACAAGAACATAGTTAGAGGCATTATTTGTTATGATTTGAACAACATTAGCCACCCCCACCTCCTCAACAACCTCATCCAATAGCTGAAACAACAAGTGGCCATCTTTTACCTTATCAGATGCATCAACTGACTTTAAAAACATGGTTCCCTGTGGGTAGAAGACAAGAAAGTTTATGATGGTACGGTTTCTTTGATCAGTCCATCCATCTGACGTGATGGTACACCCTGTTCTTGCCCATGAGTCCTTGAACTCTTGCAAATACCCATTAATGGATTGAAT

Ace file of the UniGene sp_v3.0_unigene56343

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	DUF659 domain containing protein	-	-	4.0e-38	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	74%

Source	Gene names
Sma3	GSVIVT00000858001; GSVIVT00001531001; GSVIVT00002235001; GSVIVT00003156001; GSVIVT00012114001; GSVIVT00014165001; GSVIVT00022661001; GSVIVT00024230001; GSVIVT00025712001; GSVIVT00029236001; GSVIVT00031007001; GSVIVT00031266001; GSVIVT00037518001; GSVIVT00

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	photosystem I	GO:0009522	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	DNA-directed RNA polymerase activity	GO:0003899	Molecular Function	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	hydrolase activity, hydrolyzing O-glycosyl compounds	GO:0004553	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	drug transmembrane transporter activity	GO:0015238	Molecular Function	-
Sma3	antiporter activity	GO:0015297	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3		GO:0006350	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	drug transmembrane transport	GO:0006855	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	photosynthesis	GO:0015979	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Neuraxin/MAP1B repeat	IPR000102	-	-
Sma3	Photosystem I PsaA/PsaB	IPR001280	-	-
Sma3	Glycoside hydrolase, family 1	IPR001360	-	-
Sma3	Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1	IPR001578	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Multi antimicrobial extrusion protein	IPR002528	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Zinc finger, BED-type predicted	IPR003656	-	-
Sma3	Domain of unknown function DUF250	IPR004853	-	-
Sma3	Peptidase C45, acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase	IPR005079	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	RNA polymerase Rpb1, domain 5	IPR007081	-	-
Sma3	Zinc finger, C2H2	IPR007087	-	-
Sma3	HAT dimerisation	IPR008906	-	-
Sma3		IPR011523	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-
Sma3	DNA-directed RNA pol I, largest subunit	IPR015699	-	-
Sma3		IPR015706	-	-
Sma3	Zinc finger, C2H2-like	IPR015880	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-
Sma3	MULE transposase domain	IPR018289	-	-

Source	Species	ID	Description	e value	Identity
RefSeq	Populus trichocarpa	XP_002307433.1	predicted protein [Populus trichocarpa]	1.0e-25	51%

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: coniferopsida.fasta

Fln subject: D5AB70

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 30 aas, W1: There is no M at the beginning, your sequence is shorter than subject: 64 - 93

Fln protein: NNKWPSFTLSDASTDFKNMVPCG*KTRKFMMVRFL*SVHPSDVMVHPVLAHESLNSCKYPLMD*

Protein Length: 65

Fln nts: CTAACAGTCTACCAACAAGAACATAGTTAGAGGCATTATTTGTTATGATTTGAACAACATTAGCCACCCCCACCTCCTCAACAACCTCATCCAATAGCTGAAACAACAAGTGGCCATCTTTTACCTTATCAGATGCATCAACTGACTTTAAAAACATGGTTCCCTGTGGGTAGAAGACAAGAAAGTTTATGATGGTACGGTTTCTTTGATCAGTCCATCCATCTGACGTGATGGTACACCCTGTTCTTGCCCATGAGTCCTTGAACTCTTGCAAATACCCATTAATGGATTGAAT

Fln Alignment:

F51TW9001DMG85___SFTLSDASTDFKNMVPCG*KTRKFMMVRFL*SVHPSDVMVHPVLAHESLNSCKYPLMD
D5AB70_______________SLTLSDASTDLKNMVPCGQETRKFMIVRFFPSLHPSDMMVHPVLAHDTLKSIKYSSMD

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain