|
||||||
|
UniGene Name: sp_v3.0_unigene56338
Length: 157 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene56338
A |
|
Ace file of the UniGene sp_v3.0_unigene56338
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | PREDICTED: U5 snRNP-specific protein, 116 kD n=1 Tax=Taeniopygia guttata RepID=UPI000194DBA9 | - | - | 2.0e-20 | 96% |
| FL-Next | tr=Putative uncharacterized protein; Aureococcus anophagefferens (Harmful bloom alga). | - | - | 0.0 | 82% |
| Sma3 | Elongation factor tu gtp-binding domain protein 2 | - | - | 6.505e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g06220; At5g25230; CHLREDRAFT_24423; EF-TU; EFG5; F9P14.8; GSVIVT00005644001; MICPUCDRAFT_47165; MICPUN_97033; OSTLU_35547; Os06g0608300; OsI_23659; OsJ_21930; Ot07g00360; P0556B08.14; PHATRDRAFT_45319; PHYPADRAFT_106976; PHYPADRAFT_107993; POPTRDRAFT_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | nuclear speck | GO:0016607 | Cellular Component | 0.0 | - |
| Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | regulation of embryo sac egg cell differentiation | GO:0045694 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Translation elongation factor EFG/EF2, C-terminal | IPR000640 | - | 0.0 | - |
| Sma3 | Protein synthesis factor, GTP-binding | IPR000795 | - | 0.0 | - |
| Sma3 | Translation elongation factor EFTu/EF1A, domain 2 | IPR004161 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | Translation elongation factor EFG/EF2, domain IV | IPR005517 | - | 0.0 | - |
| Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G06220.2 | MEE5 Ribosomal protein S5/Elongation factor G/III/V family protein chr1:1900524-1904583 FORWARD LENGTH=987 | 5.0e-22 | 80% |
| RefSeq | Arabidopsis thaliana | NP_172112.1 | U5 small nuclear ribonucleoprotein component [Arabidopsis thaliana] | 7.0e-22 | 80% |
| RefSeq | Populus trichocarpa | XP_002309312.1 | predicted protein [Populus trichocarpa] | 6.0e-22 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F0Y0W1
Fln msg: Distance to subject end: 300 aas, your sequence is shorter than subject: 51 - 998
Fln protein:
G
Protein Length:
52
Fln nts:
A
Fln Alignment:
F51TW9001EQBHQ___ILGTGELYLDCVMHDLRRMYSEIEIKVADPVVTFCETVVETSSLKCFAET
F0Y0W1_______________VLGTGELYLDCVMHDLREMYGAVEVKVADPVVAFCETVIETSSLKCFSET
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
