UniGene Name: sp_v3.0_unigene56238
Length: 232 nt
UniGene Fasta |
---|
>sp_v3.0_unigene56238
T |
Ace file of the UniGene sp_v3.0_unigene56238 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Heat shock protein 70 n=2 Tax=Echinostomatoidea RepID=B2RER2_9TREM | - | - | 3.0e-36 | 97% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Heat shock protein 70 | - | - | 1.09301e-43 | - |
Source | Gene names |
---|---|
Sma3 | At1g16030; At1g56410; At3g09440; At3g12580; At5g02490; At5g02500; At5g28540; At5g42020; BIP; BIP1; BIP2; BIP3; BIP4; BIP5; BIP8; BIPE2; BIPE3; BLP4; BiP; Bip; CHLREDRAFT_133650; CHLREDRAFT_133859; CHLREDRAFT_185673; F11F8; F13N6.9; F3L24.33; GRP78/BiP; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleomorph | GO:0033009 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | Chaperone DnaK | IPR012725 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G09440.1 | Heat shock protein 70 (Hsp 70) family protein chr3:2903434-2905632 REVERSE LENGTH=649 | 8.99998e-41 | 89% |
RefSeq | Arabidopsis thaliana | NP_001189847.1 | protein heat shock protein 70-3 [Arabidopsis thaliana] | 9.99995e-41 | 89% |
RefSeq | Populus trichocarpa | XP_002332588.1 | predicted protein [Populus trichocarpa] | 4.00001e-40 | 88% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRY5
Fln msg: Distance to subject end: 140 aas, your sequence is shorter than subject: 77 - 652
Fln protein:
Y
Protein Length:
78
Fln nts:
T
Fln Alignment:
F51TW9001AH578___YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSVVDKSTGKQNKITITNDK
B8LRY5_______________YSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain