|
||||||
|
UniGene Name: sp_v3.0_unigene55939
Length: 186 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene55939
A |
|
Ace file of the UniGene sp_v3.0_unigene55939
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA-directed RNA polymerase n=1 Tax=Selaginella moellendorffii RepID=D8SDS6_SELML | - | - | 6.0e-22 | 85% |
| FL-Next | sp=DNA-directed RNA polymerase II subunit RPB1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 64% |
| Sma3 | DNA-directed RNA polymerase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 7.00649e-45 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 7.00649e-45 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 7.00649e-45 | % | |
| Sma3 | Metabolic pathways | 01100 | 7.00649e-45 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g57660; At4g35800; CHLREDRAFT_169121; CHLREDRAFT_176094; CHLREDRAFT_196948; F15B8.150; F4B14.70; GSVIVT00007838001; GSVIVT00012359001; GSVIVT00013714001; GSVIVT00015507001; GSVIVT00024436001; GSVIVT00025547001; H0425E08.3; MICPUCDRAFT_36623; MICPUCDRAF |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase II, core complex | GO:0005665 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | - |
| Sma3 | GO:0006350 | Biological Process | 0.0 | - | |
| Sma3 | transcription from RNA polymerase II promoter | GO:0006366 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G57660.1 | NRPA1 nuclear RNA polymerase A1 chr3:21353746-21362814 FORWARD LENGTH=1670 | 2.0e-26 | 80% |
| RefSeq | Arabidopsis thaliana | NP_191325.1 | DNA-directed RNA polymerase I subunit A1 [Arabidopsis thaliana] | 3.0e-26 | 80% |
| RefSeq | Populus trichocarpa | XP_002300065.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 55% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P18616
Fln msg: Distance to subject end: 696 aas, your sequence is shorter than subject: 61 - 1839
Fln protein:
G
Protein Length:
62
Fln nts:
A
Fln Alignment:
F5X2MQL01BUJNO___GVIAGQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMTASKKILTPVMT
P18616_______________GCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVA-KRIKTPSLS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
