|
||||||
|
UniGene Name: sp_v3.0_unigene55843
Length: 132 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene55843
A |
|
Ace file of the UniGene sp_v3.0_unigene55843
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unc51-like kinase n=4 Tax=Arabidopsis RepID=F4IRW0_ARATH | - | - | 5.0e-13 | 92% |
| FL-Next | tr=Pkinase-domain-containing protein; Coccomyxa subellipsoidea C-169. | - | - | 0.0 | 89% |
| Sma3 | Serine/threonine-protein kinase, putative | - | - | 1.289e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G61960; At2g37840; At3g53930; At3g53930/F5K20_230; At3g61960; CHLREDRAFT_195647; F21F14.130; F5K20_230; GSVIVT00021389001; GSVIVT00026186001; LOC_Os03g02980; LOC_Os03g16130; MICPUCDRAFT_17653; MICPUN_79493; OJ1705B08.12; OJA1364E02.9; Os03g0122000; OsI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | microtubule associated complex | GO:0005875 | Cellular Component | 0.0 | - |
| Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent decarboxylase | IPR002129 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1977, DnaJ-like | IPR015399 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G53930.2 | Protein kinase superfamily protein chr3:19966541-19970580 FORWARD LENGTH=712 | 4.0e-18 | 92% |
| RefSeq | Arabidopsis thaliana | NP_190961.2 | unc51-like kinase [Arabidopsis thaliana] | 6.0e-18 | 92% |
| RefSeq | Populus trichocarpa | XP_002309098.1 | predicted protein [Populus trichocarpa] | 6.0e-18 | 92% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: I0Z0Q2
Fln msg: Distance to subject end: 113 aas, your sequence is shorter than subject: 44 - 312
Fln protein:
M
Protein Length:
45
Fln nts:
A
Fln Alignment:
F5V9AAZ02FRRKC___ADFGFARSLQPQGLAETLCGSPLYMAPEIMQSRKYDAKA
I0Z0Q2_______________ADFGFARSLQPQGLAETLCGSPLYMAPEILQFHKYNAKA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
