UniGene Name: sp_v3.0_unigene55837
Length: 214 nt
UniGene Fasta |
---|
>sp_v3.0_unigene55837
G |
Ace file of the UniGene sp_v3.0_unigene55837 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PREDICTED: similar to polyprotein n=1 Tax=Vitis vinifera RepID=UPI0001983558 | - | - | 1.0e-17 | 67% |
FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 46% |
Source | Gene names |
---|---|
Sma3 | At2g05610; F23H6.1; LOC_Os03g30350; LOC_Os10g28310; LOC_Os10g40890; LOC_Os11g38750; LOC_Os11g45000; LOC_Os12g24050; MtrDRAFT_AC150244g37v2; OSIGBa0118P15.5; OSJNBa0010C11.17; OSJNBa0087O24.13; OSJNBb0056B16.5; OSJNBb0059G13.28; Os06g0493000; Os08g0164800; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: P31843
Fln msg: STOP codon was not found. Distance to subject end: 5 aas, your sequence is shorter than subject: 70 - 142
Fln protein:
Q
Protein Length:
71
Fln nts:
G
Fln Alignment:
F5V9AAZ02JN26B___GLTNAPVTFQATMNEFFHPYLRKFVLVLFNDILV---YSKTWKEHLKHLEEV
P31843_______________GLTNALATFCNLMNNVLYEYLDHFVVVYLDDLVVYTIYSNSLHEHIKHLRVV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain