UniGene Name: sp_v3.0_unigene55741
Length: 197 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene55741
C |
Ace file of the UniGene sp_v3.0_unigene55741
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | [KAD] COG5147 Myb superfamily proteins, including transcription factors and mRNA splicing factors | - | - | 1.0e-06 | 70% |
| FL-Next | tr=MYB-like protein; Taxus globosa. | - | - | 0.0 | 80% |
| Sma3 | MYB transcription factor | - | - | 1.86e-15 | - |
| Source | Gene names |
|---|---|
| Sma3 | AIM1; At1g48000; At1g68320; At3g06490; At3g24310; At3g27810; At3g46130; At3g53200; At3g53200/T4D2_130; At5g40350; At5g49620; At5g59780; Atmyb2; F12M12.100; F5E6.18; GSVIVT00020377001; GSVIVT00020719001; GSVIVT00024392001; GSVIVT00027577001; GSVIVT00028163 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G53200.1 | AtMYB27, MYB27 myb domain protein 27 chr3:19718426-19719394 REVERSE LENGTH=238 | 1.0e-11 | 73% |
| RefSeq | Arabidopsis thaliana | NP_566980.1 | myb domain protein 27 [Arabidopsis thaliana] | 2.0e-11 | 73% |
| RefSeq | Populus trichocarpa | XP_002311700.1 | predicted protein [Populus trichocarpa] | 4.0e-13 | 59% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: F8TJT1
Fln msg: Distance to subject end: 103 aas, your sequence is shorter than subject: 65 - 250
Fln protein:
S
Protein Length:
66
Fln nts:
C
Fln Alignment:
F5V9AAZ01CPVEP___LGNRWSHIARSLPGRTDNEIKNYWRTRIMGK
F8TJT1_______________LGNRWSLIAGRLPGRTDNEIKNYWNTRLSGK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta